Result : P75061
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Phosphocarrier protein HPr (Histidine-containing protein) |
| NCBI Accession ID | U00089.2 |
| Organism | Mycoplasma pneumoniae (strain ATCC 29342 / M129) |
| Left | 66822 |
| Right | 67088 |
| Strand | + |
| Nucleotide Sequence | ATGAAGAAGATTCAAGTAGTCGTTAAAGACCCTGTGGGCATTCACGCCCGTCCTGCTAGTATTATTGCTGGTGAGGCTAATAAATTTAAATCGGAATTAAAGCTAGTATCACCAAGCGGCGTTGAAGGTAACATCAAGTCGATCATCAACTTAATGTCTTTAGGCATTAAGCAAAACGACCACATTACCATCAAGGCAGAAGGAACTGATGAAGAAGAGGCACTAAATGCTATTAAAGCAGTTTTAGAAAAACACCAAGTTATTTAA |
| Sequence | MKKIQVVVKDPVGIHARPASIIAGEANKFKSELKLVSPSGVEGNIKSIINLMSLGIKQNDHITIKAEGTDEEEALNAIKAVLEKHQVI |
| Source of smORF | Swiss-Prot |
| Function | General (non sugar-specific) component of the phosphoenolpyruvate-dependent sugar phosphotransferase system (sugar PTS). This major carbohydrate active-transport system catalyzes the phosphorylation of incoming sugar substrates concomitantly with their translocation across the cell membrane. The phosphoryl group from phosphoenolpyruvate (PEP) is transferred to the phosphoryl carrier protein HPr by enzyme I. Phospho-HPr then transfers it to the PTS EIIA domain.; P-Ser-HPr interacts with the catabolite control protein A (CcpA), forming a complex that binds to DNA at the catabolite response elements cre, operator sites preceding a large number of catabolite-regulated genes. Thus, P-Ser-HPr is a corepressor in carbon catabolite repression (CCR), a mechanism that allows bacteria to coordinate and optimize the utilization of available carbon sources. P-Ser-HPr also plays a role in inducer exclusion, in which it probably interacts with several non-PTS permeases and inhibits their transport activity (By similarity). {ECO:0000250}. |
| Pubmed ID | 8948633 11271496 12368461 14730672 |
| Domain | CDD:412221 |
| Functional Category | Others |
| Uniprot ID | P75061 |
| ORF Length (Amino Acid) | 88 |
++ More..
| Conservation Analysis |
No. of Species: 25
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 66806 | 67072 | + | NZ_CP010546.1 | Mycoplasma pneumoniae FH |
| 2 | 49376 | 49642 | + | NC_000908.2 | Mycoplasma genitalium G37 |
| 3 | 654 | 917 | + | NZ_LR214972.1 | Mycoplasmopsis bovirhinis |
| 4 | 412291 | 412554 | + | NZ_LS991951.1 | Mycoplasmopsis edwardii |
| 5 | 120089 | 120352 | + | NZ_CP011368.1 | Mycoplasmopsis canis |
| 6 | 544582 | 544845 | + | NZ_LR214986.1 | Mycoplasmopsis cynos |
| 7 | 243814 | 244077 | + | NZ_AP022325.1 | Mycoplasmopsis felis |
| 8 | 986656 | 986919 | + | NZ_LR215036.1 | Mycoplasmopsis citelli |
| 9 | 311217 | 311486 | + | NC_014014.1 | Mycoplasma crocodyli MP145 |
| 10 | 862249 | 862524 | + | NZ_LR215037.1 | Mycoplasmopsis maculosa |
| 11 | 728598 | 728867 | - | NZ_CP024962.1 | Entomoplasma freundtii |
| 12 | 109060 | 109323 | + | NZ_CP006934.1 | Spiroplasma sabaudiense Ar-1343 |
| 13 | 47370 | 47639 | - | NZ_CP024963.1 | Entomoplasma luminosum |
| 14 | 284697 | 284963 | + | NZ_LR215024.1 | Mycoplasmopsis glycophila |
| 15 | 2345378 | 2345644 | - | NZ_CP013213.1 | Erysipelothrix larvae |
| 16 | 711152 | 711418 | + | NZ_CP060715.1 | Erysipelothrix inopinata |
| 17 | 460611 | 460877 | + | NZ_CP034234.1 | Erysipelothrix piscisicarius |
| 18 | 211583 | 211849 | + | NZ_LR134439.1 | Erysipelothrix rhusiopathiae |
| 19 | 1454517 | 1454780 | - | NC_019978.1 | Halobacteroides halobius DSM 5150 |
| 20 | 485063 | 485329 | + | NZ_CP032626.1 | Apilactobacillus bombintestini |
| 21 | 4473928 | 4474191 | + | NZ_CP015756.1 | Clostridium estertheticum subsp. estertheticum |
| 22 | 1290349 | 1290615 | - | NZ_CP011391.1 | Faecalibaculum rodentium |
| 23 | 686767 | 687036 | - | NZ_CP042374.1 | Leuconostoc carnosum |
| 24 | 702439 | 702705 | + | NZ_CP023704.1 | Caldibacillus thermoamylovorans |
| 25 | 2018439 | 2018681 | + | NC_008593.1 | Clostridium novyi NT |
++ More..