Protein Information |
Information Type | Description |
---|---|
Protein name | Flagellar biosynthetic protein FliQ |
NCBI Accession ID | U36839.1 |
Organism | Treponema pallidum (strain Nichols) |
Left | 3063 |
Right | 3347 |
Strand | + |
Nucleotide Sequence | GTGATGACGCAAGGTGCGGTATTAGGCTTGATACGAGAGGGTGTTTTTCAGGTGGTGTTACTTGTCGCGCCTGTTCTGTGCACAGCGCTTGTCGTTGGCTTAATAGTGGCTATCTTTCAGGCAGTGACGTCTATTCAGGAACAAACACTTACCTTTGTTCCTAAGATGTTGACCATATTGGGAATGATTGCCCTCCTCGGTGGGTGGATGCTGACAATGCTGCAGAATTATACCGTAAGGCTGTTTGACATTATCCCTCAGTTAGTGAGGAGTGGACCTGTCTAG |
Sequence | MMTQGAVLGLIREGVFQVVLLVAPVLCTALVVGLIVAIFQAVTSIQEQTLTFVPKMLTILGMIALLGGWMLTMLQNYTVRLFDIIPQLVRSGPV |
Source of smORF | Swiss-Prot |
Function | Role in flagellar biosynthesis. |
Pubmed ID | 8529894 9665876 |
Domain | CDD:412617 |
Functional Category | Others |
Uniprot ID | P74931 |
ORF Length (Amino Acid) | 94 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 780464 | 780745 | - | NC_015714.1 | Treponema paraluiscuniculi Cuniculi A |
2 | 1356495 | 1356764 | + | NC_015500.1 | Treponema brennaborense DSM 12168 |
3 | 61445 | 61714 | + | NC_002967.9 | Treponema denticola ATCC 35405 |
4 | 799225 | 799494 | - | NZ_CP009228.1 | Treponema putidum |
5 | 1425803 | 1426072 | - | NZ_CP054142.1 | Treponema parvum |
6 | 1214272 | 1214514 | + | NC_022097.1 | Treponema pedis str. T A4 |
7 | 1724012 | 1724281 | - | NZ_CP031518.1 | Treponema ruminis |
8 | 1687658 | 1687927 | - | NZ_CP036150.1 | Oceanispirochaeta crateris |
9 | 1666668 | 1666931 | - | NC_015385.1 | Treponema succinifaciens DSM 2489 |
10 | 1726600 | 1726842 | - | NC_015732.1 | Treponema caldarium DSM 7334 |
11 | 2310692 | 2310958 | - | NC_015577.1 | Treponema azotonutricium ZAS-9 |
12 | 1324220 | 1324489 | + | NC_015578.1 | Treponema primitia ZAS-2 |
13 | 2375968 | 2376237 | - | NC_017098.1 | Spirochaeta africana DSM 8902 |
14 | 1455866 | 1456135 | - | NZ_CP047602.1 | Thermoanaerobacterium aotearoense |
15 | 1378957 | 1379226 | - | NC_015555.1 | Thermoanaerobacterium xylanolyticum LX-11 |
16 | 1445518 | 1445787 | - | NC_014410.1 | Thermoanaerobacterium thermosaccharolyticum DSM 571 |
17 | 1692137 | 1692400 | + | NC_014364.1 | Sediminispirochaeta smaragdinae DSM 11293 |
18 | 1267809 | 1268078 | + | NC_023035.1 | Salinispira pacifica |
19 | 1546096 | 1546365 | + | NZ_LR699011.1 | Roseburia hominis |
20 | 5075176 | 5075448 | - | NC_016584.1 | Desulfosporosinus orientis DSM 765 |
21 | 1077592 | 1077837 | + | NC_017583.1 | Spirochaeta thermophila DSM 6578 |
22 | 2488805 | 2489077 | - | NZ_CP007032.1 | Desulfitobacterium metallireducens DSM 15288 |
23 | 926367 | 926642 | + | NZ_LN879430.1 | Herbinix luporum |
24 | 2909639 | 2909911 | - | NC_019903.1 | Desulfitobacterium dichloroeliminans LMG P-21439 |
25 | 740499 | 740768 | + | NZ_CP017237.1 | Moorella thermoacetica |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF01656.25 | 0.88 | 22 | 5315.5 | same-strand | CobQ/CobB/MinD/ParA nucleotide binding domain |
2 | PF13614.8 | 0.88 | 22 | 5315.5 | same-strand | AAA domain |
3 | PF00448.24 | 0.88 | 22 | 4081.0 | same-strand | SRP54-type protein, GTPase domain |
4 | PF00771.22 | 1.0 | 25 | 1970 | same-strand | FHIPEP family |
5 | PF01312.21 | 0.96 | 24 | 808.5 | same-strand | FlhB HrpN YscU SpaS Family |
6 | PF01311.22 | 1.0 | 25 | 13 | same-strand | Bacterial export proteins, family 1 |
7 | PF00813.22 | 0.84 | 21 | 28 | same-strand | FliP family |
8 | PF04347.15 | 0.68 | 17 | 857 | same-strand | Flagellar biosynthesis protein, FliO |
9 | PF01052.22 | 0.84 | 21 | 1892 | same-strand | Type III flagellar switch regulator (C-ring) FliN C-term |
10 | PF02154.17 | 0.8 | 20 | 2745.5 | same-strand | Flagellar motor switch protein FliM |