Protein Information |
Information Type | Description |
---|---|
Protein name | Secretion system apparatus protein SsaS |
NCBI Accession ID | X99944.1 |
Organism | Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) |
Left | 1365 |
Right | 1631 |
Strand | + |
Nucleotide Sequence | ATGAATGATTCTGAATTGACGCAATTTGTAACGCAACTTTTATGGATCGTCCTTTTTACGTCTATGCCGGTAGTGTTGGTGGCATCGGTAGTTGGTGTCATCGTAAGCCTTGTTCAGGCCTTGACTCAAATACAGGACCAAACGCTACAGTTCATGATTAAATTATTGGCAATTGCAATAACCTTAATGGTCAGCTACCCATGGCTTAGCGGTATCCTGTTGAATTATACCCGGCAGATAATGTTACGAATTGGAGAGCATGGTTGA |
Sequence | MNDSELTQFVTQLLWIVLFTSMPVVLVASVVGVIVSLVQALTQIQDQTLQFMIKLLAIAITLMVSYPWLSGILLNYTRQIMLRIGEHG |
Source of smORF | Swiss-Prot |
Function | Part of a type III secretion system. |
Pubmed ID | 9023191 11677609 |
Domain | CDD:412617 |
Functional Category | Others |
Uniprot ID | P74891 |
ORF Length (Amino Acid) | 88 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1499379 | 1499645 | + | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
2 | 1980373 | 1980642 | + | NZ_CP006569.1 | Sodalis praecaptivus |
3 | 1178758 | 1179024 | - | NZ_CP009781.1 | Yersinia aldovae 670-83 |
4 | 3270065 | 3270334 | + | NZ_CP009787.1 | Yersinia rohdei |
5 | 4297097 | 4297366 | - | NZ_CP046293.1 | Yersinia intermedia |
6 | 29746 | 30012 | + | NZ_CP037951.1 | Parashewanella tropica |
7 | 1593370 | 1593639 | - | NZ_CP045350.1 | Vibrio aquimaris |
8 | 4297838 | 4298107 | - | NZ_CP011118.1 | Yersinia enterocolitica |
9 | 336570 | 336839 | + | NZ_CP043727.1 | Yersinia canariae |
10 | 2791481 | 2791750 | + | NZ_CP006664.1 | Edwardsiella anguillarum ET080813 |
11 | 1104426 | 1104692 | + | NZ_CP013480.3 | Pandoraea norimbergensis |
12 | 1869805 | 1870074 | - | NZ_CP009556.1 | Burkholderia oklahomensis C6786 |
13 | 34197 | 34466 | + | NZ_CP037952.1 | Parashewanella spongiae |
14 | 1471409 | 1471675 | - | NZ_CP031781.1 | Vibrio parahaemolyticus |
15 | 949605 | 949874 | + | NC_012779.2 | Edwardsiella ictaluri 93-146 |
16 | 1409317 | 1409583 | - | NZ_CP009467.1 | Vibrio harveyi |
17 | 5163943 | 5164209 | - | NZ_CP043046.1 | Pigmentiphaga aceris |
18 | 1092515 | 1092784 | - | NZ_CP014782.1 | Shewanella psychrophila |
19 | 668891 | 669106 | + | NC_020127.1 | Lawsonia intracellularis N343 |
20 | 383604 | 383873 | + | NZ_CP032487.1 | Yersinia hibernica |
21 | 1015390 | 1015656 | + | NZ_CP010310.2 | Pandoraea pulmonicola |
22 | 2817134 | 2817403 | + | NC_005085.1 | Chromobacterium violaceum ATCC 12472 |
23 | 5269597 | 5269869 | + | NC_007645.1 | Hahella chejuensis KCTC 2396 |
24 | 688482 | 688751 | - | NZ_AP018150.1 | Mycoavidus cysteinexigens |
25 | 2661699 | 2661968 | + | NC_016901.1 | Shewanella baltica OS678 |
26 | 3972719 | 3972982 | + | NZ_CP048878.1 | Spartinivicinus ruber |
27 | 2510893 | 2511162 | + | NZ_CP029495.1 | Chromobacterium phragmitis |
28 | 4410184 | 4410453 | + | NZ_CP017707.1 | Chromobacterium vaccinii |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00006.27 | 0.79 | 22 | 2631.5 | same-strand | ATP synthase alpha/beta family, nucleotide-binding domain |
2 | PF18269.3 | 0.75 | 21 | 2682 | same-strand | T3SS EscN ATPase C-terminal domain |
3 | PF00813.22 | 0.96 | 27 | 14 | same-strand | FliP family |
4 | PF01311.22 | 1.0 | 28 | 2.0 | same-strand | Bacterial export proteins, family 1 |
5 | PF01312.21 | 1.0 | 28 | 786.0 | same-strand | FlhB HrpN YscU SpaS Family |