Result : P74811

Protein Information

• Protein name: UPF0175 protein ssl1255
• NCBI Accession ID: BA000022.2
• Organism: Synechocystis sp. (strain PCC 6803 / Kazusa)
• Left: 3121684
• Right: 3121953
• Strand: -
• Nucleotide Sequence: ATGGTTGATGGTCGTCCAATGCAAATCACCTTAAATCTACCGGATAGGTTAAATCAGATCGGAGAATTTGATCAAAATGATTGGCTCCGGGAAATTGCCATTGCCCTATTTGAACAAGAACACATTTCTCTGGCTAGGGCCAGTAAAATCTCCTCCATGGAAATTATGGAATTTCAAAAACTTCTATCAGATCGGGGAATTTGTATTCACTACGATGTGGAAGAATTAGCACAGGACATTCAGCACCTACAAAATCGCAGTTGGTTATGA
• Sequence: MVDGRPMQITLNLPDRLNQIGEFDQNDWLREIAIALFEQEHISLARASKISSMEIMEFQKLLSDRGICIHYDVEELAQDIQHLQNRSWL
• Source of smORF: Swiss-Prot
• Function: The ORF matches to the profile of cl01085. Profile Description: Uncharacterized protein family (UPF0175). This family contains small proteins of unknown function.
• Pubmed ID: 8590279 8905231
• Domain: CDD:412735
• Functional Category: Others
• Uniprot ID: P74811
• ORF Length (Amino Acid): 89

Conservation Analysis

No. of Species: 2

Sr.No.	Left Position	Right Position	Strand	NCBI Accession id	Species Name
1	6885247	6885498	-	NC_019693.1	Oscillatoria acuminata PCC 6304
2	212413	212664	-	NC_019693.1	Oscillatoria acuminata PCC 6304
3	1806574	1806813	+	NZ_AP014638.1	Leptolyngbya boryana IAM M-101

Neighborhood Conservation Analysis

^* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
^* 'Small ORF' represents the entry/query analyzed.
^* Image generated using 'gggenes'(R-Package).

Neighborhood Representative Chosen(Species): NC_019693.1

Sr.No.	Domain	Co-occurrence Frequency	No. of species in which domain occurs with smORF	Median distance b/w smORF and domain bearing ORFs	Orientation relative to smORF	PFAM Information
1	PF11848.10	1.0	2	-3.0	same-strand	Domain of unknown function (DUF3368)
2	PF03683.15	1.0	2	957.5	same-strand	Uncharacterised protein family (UPF0175)