| Protein name |
UPF0150 protein ssl0738 |
| NCBI Accession ID |
BA000022.2 |
| Organism |
Synechocystis sp. (strain PCC 6803 / Kazusa) |
| Left |
2711419 |
| Right |
2711637 |
| Strand |
- |
| Nucleotide Sequence |
ATGAAAGCTGAACTAACTGCAATTATTGAAGCCGCTGAGGATGGGGGATATTGGGCTATTTGTCCAGAAATTCCTGGAGCTAATGGTCAAGGTGACACTATAGCAGAAGCAAAAGCTAGCTTGAAAAGTGCCATACAACTTATTGTTGAAGATCGCCTGGAAGATATTCGTCGAGGTTTACCTGAAGAGGCCATTGAAGAAACGATTCTAATTCCATGA |
| Sequence |
MKAELTAIIEAAEDGGYWAICPEIPGANGQGDTIAEAKASLKSAIQLIVEDRLEDIRRGLPEEAIEETILIP |
| Source of smORF |
Swiss-Prot |
| Function |
The ORF matches to the profile of cl23837. Profile Description: HicB_like antitoxin of bacterial toxin-antitoxin system. This family consists of several bacterial HicB related proteins. The function of HicB is unknown although it is thought to be involved in pilus formation. It has been speculated that HicB performs a function antagonistic to that of pili and yet is necessary for invasion of certain niches. |
| Pubmed ID |
8590279
8905231
|
| Domain |
CDD:420040 |
| Functional Category |
Others |
| Uniprot ID |
P74794
|
| ORF Length (Amino Acid) |
72 |