| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | UPF0150 protein ssr1258 |
| NCBI Accession ID | BA000022.2 |
| Organism | Synechocystis sp. (strain PCC 6803 / Kazusa) |
| Left | 3428962 |
| Right | 3429171 |
| Strand | + |
| Nucleotide Sequence | ATGAACAAGCAAGAATTTTATGTTCTTATTGAAAGGGATGAAGATGGTATTTACATAGGTGAAGTCCCACAACTTAAAGCTTGCTACAGTCAGGGGGAGACCATTGATGAGCTTATGCAAAATATTCGTGAGGTTATCGAATTATGTCTTGAAGAGATTGAATTGGAATCTACTTCTGAGTTTATCGGCATCCAAAAAGTGGTGGTCTGA |
| Sequence | MNKQEFYVLIERDEDGIYIGEVPQLKACYSQGETIDELMQNIREVIELCLEEIELESTSEFIGIQKVVV |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl23837. Profile Description: HicB_like antitoxin of bacterial toxin-antitoxin system. This family consists of several bacterial HicB related proteins. The function of HicB is unknown although it is thought to be involved in pilus formation. It has been speculated that HicB performs a function antagonistic to that of pili and yet is necessary for invasion of certain niches. |
| Pubmed ID | 8905231 |
| Domain | CDD:420040 |
| Functional Category | Others |
| Uniprot ID | P74641 |
| ORF Length (Amino Acid) | 69 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 876594 | 876809 | - | NC_019753.1 | Crinalium epipsammum PCC 9333 |
| 2 | 3812727 | 3812936 | - | NC_019748.1 | Stanieria cyanosphaera PCC 7437 |
| 3 | 3685167 | 3685379 | + | NC_010296.1 | Microcystis aeruginosa NIES-843 |
| 4 | 3365902 | 3366120 | - | NZ_CP031941.1 | Nostoc sphaeroides |
| 5 | 7220206 | 7220436 | + | NZ_CP061800.1 | Desulfonema magnum |
| 6 | 5963824 | 5964039 | + | NZ_CP054698.1 | Nostoc edaphicum CCNP1411 |
| 7 | 88306 | 88518 | + | NC_019695.1 | Chroococcidiopsis thermalis PCC 7203 |
| 8 | 886899 | 887126 | - | NC_015703.1 | Runella slithyformis DSM 19594 |
| 9 | 1652765 | 1652992 | + | NC_015681.1 | Thermodesulfatator indicus DSM 15286 |
| 10 | 3626855 | 3627082 | + | NZ_CP009515.1 | Methanosarcina lacustris Z-7289 |
| 11 | 1675605 | 1675823 | + | NZ_CP009515.1 | Methanosarcina lacustris Z-7289 |
| 12 | 53842 | 54060 | - | NC_019977.1 | Methanomethylovorans hollandica DSM 15978 |
| 13 | 713062 | 713280 | + | NC_008346.1 | Syntrophomonas wolfei subsp. wolfei str. Goettingen G311 |
| 14 | 2287321 | 2287533 | + | NC_003901.1 | Methanosarcina mazei Go1 |
| 15 | 1657761 | 1657982 | - | NZ_CP058215.1 | Methanolobus zinderi |
| 16 | 897256 | 897468 | + | NC_003552.1 | Methanosarcina acetivorans C2A |
| 17 | 5043454 | 5043672 | + | NC_003552.1 | Methanosarcina acetivorans C2A |
| 18 | 1062724 | 1062942 | - | NZ_CP009506.1 | Methanosarcina siciliae T4/M |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF07927.14 | 0.75 | 12 | 0.0 | same-strand | HicA toxin of bacterial toxin-antitoxin, |