Result : P74564
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Photosystem I reaction center subunit PsaK 2 (Photosystem I subunit X 2) |
| NCBI Accession ID | |
| Organism | Synechocystis sp. (strain PCC 6803 / Kazusa) |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | |
| Sequence | MFNTALLLAQASPTTAGWSLSVGIIMCLCNVFAFVIGYFAIQKTGKGKDLALPQLASKKTFGLPELLATMSFGHILGAGMVLGLASSGIL |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl11425. Profile Description: Photosystem I psaG / psaK. Members of this protein family are the PsaK of the photosystem I reaction center. Photosystems I and II occur together in the same sets of organisms. Photosystem I uses light energy to transfer electrons from plastocyanin to ferredoxin, while photosystem II uses light energy to split water and releases molecular oxygen. [Energy metabolism, Photosynthesis] |
| Pubmed ID | 8905231 |
| Domain | CDD:416266 |
| Functional Category | Others |
| Uniprot ID | P74564 |
| ORF Length (Amino Acid) | 90 |
++ More..
| Conservation Analysis |
No. of Species: 15
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1744081 | 1744356 | + | NC_019689.1 | Pleurocapsa sp. PCC 7327 |
| 2 | 3745515 | 3745754 | + | NC_014501.1 | Gloeothece verrucosa PCC 7822 |
| 3 | 5800991 | 5801245 | - | NC_014501.1 | Gloeothece verrucosa PCC 7822 |
| 4 | 400122 | 400394 | + | NC_011729.1 | Gloeothece citriformis PCC 7424 |
| 5 | 3248157 | 3248423 | - | NC_010296.1 | Microcystis aeruginosa NIES-843 |
| 6 | 1189014 | 1189286 | + | NC_019748.1 | Stanieria cyanosphaera PCC 7437 |
| 7 | 4974471 | 4974749 | - | NC_019753.1 | Crinalium epipsammum PCC 9333 |
| 8 | 3083097 | 3083369 | + | NC_019780.1 | Dactylococcopsis salina PCC 8305 |
| 9 | 4037223 | 4037507 | + | NC_019729.1 | Oscillatoria nigro-viridis PCC 7112 |
| 10 | 395559 | 395831 | + | NZ_CP042326.1 | Euhalothece natronophila Z-M001 |
| 11 | 3953657 | 3953911 | - | NZ_CP021983.2 | Halomicronema hongdechloris C2206 |
| 12 | 3426962 | 3427228 | - | NZ_AP014638.1 | Leptolyngbya boryana IAM M-101 |
| 13 | 964474 | 964746 | + | NC_019776.1 | Cyanobacterium aponinum PCC 10605 |
| 14 | 3147658 | 3147921 | + | NC_019776.1 | Cyanobacterium aponinum PCC 10605 |
| 15 | 763850 | 764101 | - | NZ_CP018092.1 | Synechococcus lividus PCC 6715 |
| 16 | 2233126 | 2233377 | + | NZ_AP018202.1 | Thermostichus vulcanus NIES-2134 |
| 17 | 2364107 | 2364358 | + | NC_004113.1 | Thermosynechococcus vestitus BP-1 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_019689.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00697.24 | 0.93 | 14 | 129.0 | opposite-strand | N-(5'phosphoribosyl)anthranilate (PRA) isomerase |
++ More..