| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C (Asp/Glu-ADT subunit C) (EC 6.3.5.-) |
| NCBI Accession ID | CP000471.1 |
| Organism | Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) |
| Left | 819604 |
| Right | 819891 |
| Strand | - |
| Nucleotide Sequence | ATGTCCGTTACCAAAGAGACCGTACAACACGTGGCCAACCTGGCCCGATTACAGTTCAATGAAGAAGAGACCGAACGCTTTTCCGGCCAAATCTCCCGCATTGTCGACCTAATGGATGCCCTCAGCAAACTCCCTACTGAAGGGGTTAAACCCATGTCCCACGCCGTGGATATGGCTATCCCCCAACGGGACGATGTGGTCACCAACGGCAACCAACGCGACACCATGCTCGCCAATGCCCCTGATGCCGAAAAAGGTCACTTCCGCGTTCCCAAAGTTATCGAATAA |
| Sequence | MSVTKETVQHVANLARLQFNEEETERFSGQISRIVDLMDALSKLPTEGVKPMSHAVDMAIPQRDDVVTNGNQRDTMLANAPDAEKGHFRVPKVIE |
| Source of smORF | Swiss-Prot |
| Function | Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln). {ECO:0000255|HAMAP-Rule:MF_00122}. |
| Pubmed ID | 19465526 |
| Domain | CDD:412411 |
| Functional Category | Others |
| Uniprot ID | A0L5G1 |
| ORF Length (Amino Acid) | 95 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 819604 | 819891 | - | NC_008576.1 | Magnetococcus marinus MC-1 |
| 2 | 2107306 | 2107593 | - | NZ_CP041025.1 | Paremcibacter congregatus |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02934.17 | 1.0 | 2 | 1501.0 | same-strand | GatB/GatE catalytic domain |
| 2 | PF02637.20 | 1.0 | 2 | 1501.0 | same-strand | GatB domain |
| 3 | PF01425.23 | 1.0 | 2 | 12.5 | same-strand | Amidase |