Result : P74095
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Hydrogenase maturation factor HypC |
| NCBI Accession ID | BA000022.2 |
| Organism | Synechocystis sp. (strain PCC 6803 / Kazusa) |
| Left | 1757284 |
| Right | 1757514 |
| Strand | - |
| Nucleotide Sequence | ATGTGTCTAGCCCTACCTGGCCAGGTTGTCAGTTTAATGCCCAACTCCGATCCCCTGTTACTGACGGGAAAGGTTAGCTTTGGGGGCATCATTAAAACCATTAGCCTTGCCTACGTACCCGAGGTTAAGGTGGGGGATTACGTGATTGTCCATGTGGGCTTTGCCATTAGCATTGTGGACGAAGAGGCGGCCCAGGAAACTTTGATAGACTTGGCAGAAATGGGAGTTTAA |
| Sequence | MCLALPGQVVSLMPNSDPLLLTGKVSFGGIIKTISLAYVPEVKVGDYVIVHVGFAISIVDEEAAQETLIDLAEMGV |
| Source of smORF | Swiss-Prot |
| Function | Involved in the maturation of [NiFe] hydrogenases. Involved in the biosynthesis of the Fe(CN)(2)CO cofactor. {ECO:0000250|UniProtKB:P0AAM3}. |
| Pubmed ID | 8905231 |
| Domain | CDD:412356 |
| Functional Category | Others |
| Uniprot ID | P74095 |
| ORF Length (Amino Acid) | 76 |
++ More..
| Conservation Analysis |
No. of Species: 43
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 7577344 | 7577577 | + | NC_019693.1 | Oscillatoria acuminata PCC 6304 |
| 2 | 150923 | 151159 | - | NC_009929.1 | Acaryochloris marina MBIC11017 |
| 3 | 4960287 | 4960517 | + | NC_019695.1 | Chroococcidiopsis thermalis PCC 7203 |
| 4 | 706405 | 706644 | - | NC_014501.1 | Gloeothece verrucosa PCC 7822 |
| 5 | 4091513 | 4091767 | - | NC_019776.1 | Cyanobacterium aponinum PCC 10605 |
| 6 | 4115015 | 4115254 | - | NC_011729.1 | Gloeothece citriformis PCC 7424 |
| 7 | 953241 | 953489 | + | NZ_AP017928.1 | Methylocaldum marinum |
| 8 | 1947509 | 1947775 | + | NZ_CP063849.1 | Paludibaculum fermentans |
| 9 | 2118912 | 2119160 | + | NZ_CP047491.1 | Microbulbifer hydrolyticus |
| 10 | 3960405 | 3960662 | + | NZ_CP039456.1 | Changchengzhania lutea |
| 11 | 802537 | 802782 | - | NZ_AP014638.1 | Leptolyngbya boryana IAM M-101 |
| 12 | 1565213 | 1565449 | + | NZ_CP029176.1 | Acidibrevibacterium fodinaquatile |
| 13 | 588315 | 588581 | + | NC_011831.1 | Chloroflexus aggregans DSM 9485 |
| 14 | 198291 | 198518 | + | NZ_CP017715.1 | Marinobacter salinus |
| 15 | 7605632 | 7605886 | + | NZ_CP036273.1 | Urbifossiella limnaea |
| 16 | 1551492 | 1551737 | + | NC_016609.1 | Niastella koreensis GR20-10 |
| 17 | 6470038 | 6470283 | + | NC_010162.1 | Sorangium cellulosum So ce56 |
| 18 | 429206 | 429454 | + | NZ_CP029463.1 | Flavobacterium sediminis |
| 19 | 1333100 | 1333357 | - | NZ_CP022743.1 | Mucilaginibacter xinganensis |
| 20 | 1779181 | 1779417 | - | NC_007626.1 | Magnetospirillum magneticum AMB-1 |
| 21 | 3541170 | 3541436 | - | NC_012483.1 | Acidobacterium capsulatum ATCC 51196 |
| 22 | 1753328 | 1753585 | - | NZ_AP017313.1 | Mucilaginibacter gotjawali |
| 23 | 4248271 | 4248510 | + | NZ_CP016210.1 | Azoarcus olearius |
| 24 | 2893046 | 2893300 | - | NZ_CP014143.1 | Microbulbifer aggregans |
| 25 | 2278580 | 2278834 | - | NC_015510.1 | Haliscomenobacter hydrossis DSM 1100 |
| 26 | 1750324 | 1750566 | + | NZ_AP021898.1 | Akkermansia muciniphila |
| 27 | 2671715 | 2671948 | + | NZ_CP054012.1 | Parabacteroides distasonis |
| 28 | 4650251 | 4650487 | - | NC_009441.1 | Flavobacterium johnsoniae UW101 |
| 29 | 1514677 | 1514910 | - | NC_008709.1 | Psychromonas ingrahamii 37 |
| 30 | 2037174 | 2037416 | + | NZ_CP043473.1 | Chromobacterium paludis |
| 31 | 570306 | 570530 | - | NZ_CP010835.1 | Pyrococcus kukulkanii |
| 32 | 2759238 | 2759495 | + | NZ_CP059560.1 | Aromatoleum petrolei |
| 33 | 902493 | 902717 | + | NZ_LN999010.1 | Thermococcus chitonophagus |
| 34 | 2332019 | 2332249 | + | NC_023065.1 | Magnetospirillum gryphiswaldense MSR-1 v2 |
| 35 | 296235 | 296474 | + | NZ_CP037867.1 | Hydrogenophaga pseudoflava |
| 36 | 2867812 | 2868066 | + | NZ_CP011367.1 | Thioalkalivibrio versutus |
| 37 | 4270457 | 4270705 | - | NZ_CP023865.1 | Actinoplanes teichomyceticus ATCC 31121 |
| 38 | 2084624 | 2084881 | - | NC_008781.1 | Polaromonas naphthalenivorans CJ2 |
| 39 | 1935165 | 1935404 | + | NZ_CP022423.1 | Vitreoscilla filiformis |
| 40 | 1199354 | 1199581 | - | NC_000868.1 | Pyrococcus abyssi GE5 |
| 41 | 548926 | 549153 | + | NZ_CP023154.1 | Pyrococcus furiosus DSM 3638 |
| 42 | 176007 | 176237 | + | NZ_CP009788.1 | Geobacter pickeringii |
| 43 | 144081 | 144311 | - | NC_007517.1 | Geobacter metallireducens GS-15 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_AP017928.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02492.21 | 0.6 | 26 | 1203.0 | same-strand | CobW/HypB/UreG, nucleotide-binding domain |
| 2 | PF01300.20 | 0.65 | 28 | 4.0 | same-strand | Telomere recombination |
| 3 | PF07503.14 | 0.65 | 28 | 4.0 | same-strand | HypF finger |
| 4 | PF17788.3 | 0.79 | 34 | 4.0 | same-strand | HypF Kae1-like domain |
| 5 | PF00708.20 | 0.65 | 28 | 4.0 | same-strand | Acylphosphatase |
| 6 | PF01924.18 | 0.74 | 32 | -3.0 | same-strand | Hydrogenase formation hypA family |
| 7 | PF02769.24 | 0.72 | 31 | 1123 | same-strand | AIR synthase related protein, C-terminal domain |
| 8 | PF00586.26 | 0.72 | 31 | 1123 | same-strand | AIR synthase related protein, N-terminal domain |
++ More..