Protein Information |
Information Type | Description |
---|---|
Protein name | Phycobilisome degradation protein NblA homolog 1 |
NCBI Accession ID | BA000022.2 |
Organism | Synechocystis sp. (strain PCC 6803 / Kazusa) |
Left | 1523796 |
Right | 1523984 |
Strand | - |
Nucleotide Sequence | ATGAAACCTGAATCCTTCGATCTCACCATTGAACAAATGTTTGAGTTCCGTCGCATGCAGGATGCCACCGCCAACATCAGCCAGGAGCAAGCCCTGGAACTTTTGGTCCAAGCCTCTCGACTGTTGATGATTAAATCCAACGTCATCCGGGACTTAATGCGCCAGGCTCCCCTGGAGCCCCTAGGTTAA |
Sequence | MKPESFDLTIEQMFEFRRMQDATANISQEQALELLVQASRLLMIKSNVIRDLMRQAPLEPLG |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of pfam04485. Profile Description: Phycobilisome degradation protein nblA. In the cyanobacterium Synechococcus PCC 7942, nblA triggers degradation of light-harvesting phycobiliproteins in response to deprivation nutrients including nitrogen, phosphorus and sulphur. The mechanism of nblA function is not known, but it has been hypothesized that nblA may act by disrupting phycobilisome structure, activating a protease or tagging phycobiliproteins for proteolysis. Members of this family have also been identified in the chloroplasts of some red algae. |
Pubmed ID | 8905231 |
Domain | CDD:398271 |
Functional Category | Others |
Uniprot ID | P73891 |
ORF Length (Amino Acid) | 62 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 919201 | 919401 | - | NC_019748.1 | Stanieria cyanosphaera PCC 7437 |
2 | 393763 | 393948 | - | NZ_AP018202.1 | Thermostichus vulcanus NIES-2134 |
3 | 31799 | 31984 | + | NC_004113.1 | Thermosynechococcus vestitus BP-1 |
4 | 2130942 | 2131127 | + | NZ_CP018092.1 | Synechococcus lividus PCC 6715 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00132.26 | 0.75 | 3 | 204 | opposite-strand | Bacterial transferase hexapeptide (six repeats) |
2 | PF04613.16 | 0.75 | 3 | 204 | opposite-strand | UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase, LpxD |