Result : P73634
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | ATP-dependent Clp protease adapter protein ClpS |
| NCBI Accession ID | BA000022.2 |
| Organism | Synechocystis sp. (strain PCC 6803 / Kazusa) |
| Left | 1226686 |
| Right | 1226982 |
| Strand | - |
| Nucleotide Sequence | GTGATTAGCAACGCCGCCACCAGCACCCCCGATCGCCTAACTAGCACAGTCCGCAAAACCTATCCCAACTTTAAAGTAATTGTCCTCAACGACGATTTCAACACGTTTCAGCATGTGTCCGATTGCTTGCTTAAATACATCCCCGGCATGACCGGCGATCGGGCTTGGGAATTAACTAATCAAGTCCACTTCGACGGCTTAGCCATTGTTTGGGTGGGGCCCCAGGAGCAGGCGGAATTGTACCATCAACAACTACGGCGGGAAGGTTTGACCATGGCTCCCCTAGAAAAGGCTTAA |
| Sequence | MISNAATSTPDRLTSTVRKTYPNFKVIVLNDDFNTFQHVSDCLLKYIPGMTGDRAWELTNQVHFDGLAIVWVGPQEQAELYHQQLRREGLTMAPLEKA |
| Source of smORF | Swiss-Prot |
| Function | Involved in the modulation of the specificity of the ClpAP-mediated ATP-dependent protein degradation. {ECO:0000255|HAMAP-Rule:MF_00302}. |
| Pubmed ID | 8905231 |
| Domain | CDD:412656 |
| Functional Category | Others |
| Uniprot ID | P73634 |
| ORF Length (Amino Acid) | 98 |
++ More..
| Conservation Analysis |
No. of Species: 31
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 234829 | 235122 | + | NC_014501.1 | Gloeothece verrucosa PCC 7822 |
| 2 | 4976123 | 4976416 | + | NC_011729.1 | Gloeothece citriformis PCC 7424 |
| 3 | 4834681 | 4834974 | - | NZ_CP047242.1 | Trichormus variabilis 0441 |
| 4 | 5119456 | 5119749 | + | NC_010628.1 | Nostoc punctiforme PCC 73102 |
| 5 | 4063934 | 4064227 | - | NC_019771.1 | Anabaena cylindrica PCC 7122 |
| 6 | 1140432 | 1140725 | + | NC_019753.1 | Crinalium epipsammum PCC 9333 |
| 7 | 351847 | 352140 | - | NC_019695.1 | Chroococcidiopsis thermalis PCC 7203 |
| 8 | 2966828 | 2967121 | + | NZ_CP031941.1 | Nostoc sphaeroides |
| 9 | 3931937 | 3932230 | - | NZ_CP024785.1 | Nostoc flagelliforme CCNUN1 |
| 10 | 942655 | 942948 | + | NZ_CP054698.1 | Nostoc edaphicum CCNP1411 |
| 11 | 614826 | 615077 | - | NC_010296.1 | Microcystis aeruginosa NIES-843 |
| 12 | 2247148 | 2247441 | + | NC_014248.1 | 'Nostoc azollae' 0708 |
| 13 | 5046439 | 5046732 | + | NC_019751.1 | Calothrix sp. PCC 6303 |
| 14 | 879483 | 879776 | - | NZ_CP060822.1 | Cylindrospermopsis curvispora GIHE-G1 |
| 15 | 2182803 | 2183105 | - | NZ_CP042326.1 | Euhalothece natronophila Z-M001 |
| 16 | 2615860 | 2616153 | - | NC_019693.1 | Oscillatoria acuminata PCC 6304 |
| 17 | 965795 | 966088 | - | NC_019689.1 | Pleurocapsa sp. PCC 7327 |
| 18 | 19521 | 19823 | + | NC_019780.1 | Dactylococcopsis salina PCC 8305 |
| 19 | 3524712 | 3525005 | + | NC_019748.1 | Stanieria cyanosphaera PCC 7437 |
| 20 | 230124 | 230450 | + | NZ_CP021983.2 | Halomicronema hongdechloris C2206 |
| 21 | 1980455 | 1980706 | - | NZ_CP018092.1 | Synechococcus lividus PCC 6715 |
| 22 | 663237 | 663521 | - | NZ_AP018202.1 | Thermostichus vulcanus NIES-2134 |
| 23 | 1120660 | 1120944 | + | NC_004113.1 | Thermosynechococcus vestitus BP-1 |
| 24 | 6439736 | 6440029 | + | NC_019729.1 | Oscillatoria nigro-viridis PCC 7112 |
| 25 | 164307 | 164612 | - | NC_019776.1 | Cyanobacterium aponinum PCC 10605 |
| 26 | 6155877 | 6156155 | - | NZ_AP014638.1 | Leptolyngbya boryana IAM M-101 |
| 27 | 3945689 | 3945985 | - | NC_009925.1 | Acaryochloris marina MBIC11017 |
| 28 | 2396734 | 2397021 | - | NC_005125.1 | Gloeobacter violaceus PCC 7421 |
| 29 | 3404215 | 3404502 | - | NC_022600.1 | Gloeobacter kilaueensis JS1 |
| 30 | 1419086 | 1419382 | - | NC_005042.1 | Prochlorococcus marinus subsp. marinus str. CCMP1375 |
| 31 | 659933 | 660226 | + | NC_019675.1 | Cyanobium gracile PCC 6307 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_014501.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF09876.11 | 0.71 | 22 | 6.0 | same-strand | Predicted metal-binding protein (DUF2103) |
++ More..