Protein Information |
Information Type | Description |
---|---|
Protein name | Photosystem I reaction center subunit XII (PSI-M) |
NCBI Accession ID | BA000022.2 |
Organism | Synechocystis sp. (strain PCC 6803 / Kazusa) |
Left | 467201 |
Right | 467296 |
Strand | + |
Nucleotide Sequence | ATGGCATTATCCGACACCCAAATTTTGGCAGCCCTAGTGGTTGCCCTCCTGCCTGCTTTCCTGGCTTTCCGTCTCTCCACGGAACTTTATAAGTAA |
Sequence | MALSDTQILAALVVALLPAFLAFRLSTELYK |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of cl26892. Profile Description: Photosystem I protein M (PsaM). Members of this protein family are PsaM, which is subunit XII of the photosystem I reaction center. This protein is found in both the Cyanobacteria and the chloroplasts of plants, but is absent from non-oxygenic photosynthetic bacteria such as Rhodobacter sphaeroides. Species that contain photosystem I also contain photosystem II, which splits water and releases molecular oxygen. The seed alignment for this model includes sequences from pfam07465 and additional sequences, as from Prochlorococcus. [Energy metabolism, Photosynthesis] |
Pubmed ID | 8905231 |
Domain | CDD:421407 |
Functional Category | Others |
Uniprot ID | P72986 |
ORF Length (Amino Acid) | 31 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 5608071 | 5608166 | + | NC_014501.1 | Gloeothece verrucosa PCC 7822 |
2 | 179299 | 179394 | + | NC_004113.1 | Thermosynechococcus vestitus BP-1 |
3 | 487438 | 487533 | + | NZ_AP018202.1 | Thermostichus vulcanus NIES-2134 |
4 | 120487 | 120582 | + | NC_011729.1 | Gloeothece citriformis PCC 7424 |
5 | 2332514 | 2332609 | + | NZ_AP014638.1 | Leptolyngbya boryana IAM M-101 |
6 | 1047466 | 1047561 | - | NC_019729.1 | Oscillatoria nigro-viridis PCC 7112 |
7 | 4251592 | 4251687 | - | NZ_CP021983.2 | Halomicronema hongdechloris C2206 |
8 | 2391654 | 2391749 | + | NC_019693.1 | Oscillatoria acuminata PCC 6304 |
9 | 132389 | 132484 | + | NC_019695.1 | Chroococcidiopsis thermalis PCC 7203 |
10 | 3920985 | 3921083 | - | NC_019748.1 | Stanieria cyanosphaera PCC 7437 |
11 | 2321343 | 2321438 | - | NC_019753.1 | Crinalium epipsammum PCC 9333 |
12 | 212880 | 212975 | + | NZ_CP018092.1 | Synechococcus lividus PCC 6715 |
13 | 2242407 | 2242502 | + | NC_019689.1 | Pleurocapsa sp. PCC 7327 |
14 | 969799 | 969894 | + | NC_019780.1 | Dactylococcopsis salina PCC 8305 |
15 | 823503 | 823595 | + | NC_010296.1 | Microcystis aeruginosa NIES-843 |
16 | 1555061 | 1555156 | + | NZ_CP042326.1 | Euhalothece natronophila Z-M001 |
17 | 2373471 | 2373566 | + | NC_019776.1 | Cyanobacterium aponinum PCC 10605 |
18 | 1516745 | 1516843 | - | NC_019751.1 | Calothrix sp. PCC 6303 |
19 | 2734622 | 2734717 | - | NZ_CP060822.1 | Cylindrospermopsis curvispora GIHE-G1 |
20 | 4160062 | 4160157 | - | NC_014248.1 | 'Nostoc azollae' 0708 |
21 | 4031053 | 4031148 | + | NC_019771.1 | Anabaena cylindrica PCC 7122 |
22 | 3765173 | 3765271 | - | NZ_CP047242.1 | Trichormus variabilis 0441 |