ProsmORF-pred
Result : P72759
Protein Information
Information Type Description
Protein name Carboxysome shell vertex protein CcmL (Carbon dioxide concentrating mechanism protein CcmL)
NCBI Accession ID BA000022.2
Organism Synechocystis sp. (strain PCC 6803 / Kazusa)
Left 218407
Right 218709
Strand -
Nucleotide Sequence ATGCAACTTGCCAAAGTTTTGGGGACCGTGGTCAGTACATCGAAGACACCGAACTTAACCGGCGTCAAGCTGCTTTTAGTTCAGTTCCTCGACACCAAAGGTCAACCCCTGGAACGCTATGAAGTGGCGGGGGATGTGGTAGGTGCAGGCTTAAATGAATGGGTGCTGGTGGCCCGGGGTAGTGCCGCCCGTAAGGAACGGGGCAATGGCGATCGCCCTTTGGATGCCATGGTGGTGGGCATCATCGACACAGTTAATGTGGCTAGTGGCTCCCTCTACAACAAGAGGGATGATGGGAGATAA
Sequence MQLAKVLGTVVSTSKTPNLTGVKLLLVQFLDTKGQPLERYEVAGDVVGAGLNEWVLVARGSAARKERGNGDRPLDAMVVGIIDTVNVASGSLYNKRDDGR
Source of smORF Swiss-Prot
Function Probably forms vertices in the carboxysome, a polyhedral inclusion where RuBisCO (ribulose bisphosphate carboxylase, rbcL-rbcS) is sequestered. Has been modeled to induce curvature upon insertion into an otherwise flat hexagonal molecular layer of CcmK subunits. {ECO:0000255|HAMAP-Rule:MF_00858, ECO:0000305|Pubmed:18292340}.
Pubmed ID 8905231 17993516 18292340
Domain CDD:413110
Functional Category Others
Uniprot ID P72759
ORF Length (Amino Acid) 100
++ More..
Conservation Analysis
Conservation Analysis
No. of Species: 44
Sr.No. Left Position Right Position Strand NCBI Accession id Species Name
1 1002980 1003288 - NC_019776.1 Cyanobacterium aponinum PCC 10605
2 1508270 1508581 - NC_011729.1 Gloeothece citriformis PCC 7424
3 4395218 4395529 - NC_010296.1 Microcystis aeruginosa NIES-843
4 3220100 3220408 + NC_014501.1 Gloeothece verrucosa PCC 7822
5 374042 374350 - NC_019748.1 Stanieria cyanosphaera PCC 7437
6 353588 353911 + NC_019689.1 Pleurocapsa sp. PCC 7327
7 1130101 1130415 - NC_019695.1 Chroococcidiopsis thermalis PCC 7203
8 6183559 6183864 + NC_019729.1 Oscillatoria nigro-viridis PCC 7112
9 1257118 1257417 - NZ_AP014638.1 Leptolyngbya boryana IAM M-101
10 710690 710992 - NC_022600.1 Gloeobacter kilaueensis JS1
11 1795359 1795661 + NC_019753.1 Crinalium epipsammum PCC 9333
12 2248293 2248595 - NC_005125.1 Gloeobacter violaceus PCC 7421
13 5379766 5380068 + NC_010628.1 Nostoc punctiforme PCC 73102
14 3919002 3919304 + NZ_CP031941.1 Nostoc sphaeroides
15 4309367 4309669 - NZ_CP024785.1 Nostoc flagelliforme CCNUN1
16 1467754 1468050 + NZ_CP042326.1 Euhalothece natronophila Z-M001
17 1752010 1752312 + NZ_CP021983.2 Halomicronema hongdechloris C2206
18 772671 772973 - NZ_CP060822.1 Cylindrospermopsis curvispora GIHE-G1
19 3397322 3397624 - NZ_CP054698.1 Nostoc edaphicum CCNP1411
20 531973 532278 - NZ_CP047242.1 Trichormus variabilis 0441
21 1795086 1795376 + NC_019780.1 Dactylococcopsis salina PCC 8305
22 2442067 2442375 + NC_019693.1 Oscillatoria acuminata PCC 6304
23 592717 593016 - NC_019771.1 Anabaena cylindrica PCC 7122
24 814827 815129 - NC_019751.1 Calothrix sp. PCC 6303
25 5442344 5442631 + NC_009925.1 Acaryochloris marina MBIC11017
26 1935080 1935385 - NC_014248.1 'Nostoc azollae' 0708
27 989360 989659 + NZ_AP018202.1 Thermostichus vulcanus NIES-2134
28 966722 967021 - NC_004113.1 Thermosynechococcus vestitus BP-1
29 845730 846029 + NZ_CP018092.1 Synechococcus lividus PCC 6715
30 5565056 5565325 + NZ_CP017269.1 Geosporobacter ferrireducens
31 1672192 1672464 - NZ_LR134442.1 Propionibacterium australiense
32 2823029 2823301 + NZ_CP033719.1 Propionibacterium acidifaciens
33 1833677 1833961 + NZ_CP048436.1 Flavonifractor plautii
34 3187570 3187839 + NZ_LR134406.1 Arachnia propionica
35 1566452 1566730 - NZ_CP029256.1 Christensenella minuta
36 560977 561264 - NZ_CP059066.1 Koleobacter methoxysyntrophicus
37 1860197 1860484 + NC_012691.1 Tolumonas auensis DSM 9187
38 1394264 1394530 - NZ_CP015421.1 Rhodovulum sulfidophilum
39 850960 851241 + NC_011837.1 Clostridium kluyveri NBRC 12016
40 1086840 1087109 + NC_017584.1 Rhodospirillum rubrum F11
41 116234 116521 - NZ_CP061725.1 Micromonospora craniellae
42 5222307 5222600 - NZ_AP018920.1 Pseudonocardia autotrophica
43 3023217 3023483 + NZ_CP027002.1 [Ruminococcus] gnavus ATCC 29149
44 2026554 2026832 - NZ_CP017237.1 Moorella thermoacetica
++ More..
Neighborhood Conservation Analysis
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Conservation Analysis
Neighborhood Representative Chosen(Species): NC_019776.1
Sr.No. Domain Co-occurrence Frequency No. of species in which domain occurs with smORF Median distance b/w smORF and domain bearing ORFs Orientation relative to smORF PFAM Information
1 PF00101.22 0.66 29 107 same-strand Ribulose bisphosphate carboxylase, small chain
2 PF00936.21 1.0 44 533 same-strand BMC domain
++ More..