Protein Information |
Information Type | Description |
---|---|
Protein name | Sec-independent protein translocase protein TatA |
NCBI Accession ID | Z82004.1 |
Organism | Rhodococcus erythropolis (Arthrobacter picolinophilus) |
Left | 6051 |
Right | 6347 |
Strand | + |
Nucleotide Sequence | ATGGGAGCCATGAGCCCCTGGCACTGGGCCATCGTCGCGCTGGTCGTCGTCATCCTGTTCGGTTCCAAGAAGCTGCCCGACGCGGCTCGTGGACTCGGCCGTTCGCTCCGCATCTTCAAGAGCGAGGTCAAGGAGATGCAGAACGACAACAGCACGCCGGCGCCCACCGCGCAGAGTGCGCCCCCCCCGCAGAGCGCGCCCGCCGAGCTGCCCGTGGCGGACACCACCACCGCACCGGTCACTCCTCCGGCGCCGGTGCAGCCGCAGTCGCAGCACACCGAGCCCAAGTCGGCGTAG |
Sequence | MGAMSPWHWAIVALVVVILFGSKKLPDAARGLGRSLRIFKSEVKEMQNDNSTPAPTAQSAPPPQSAPAELPVADTTTAPVTPPAPVQPQSQHTEPKSA |
Source of smORF | Swiss-Prot |
Function | Part of the twin-arginine translocation (Tat) system that transports large folded proteins containing a characteristic twin-arginine motif in their signal peptide across membranes. TatA could form the protein-conducting channel of the Tat system. {ECO:0000255|HAMAP-Rule:MF_00236}. |
Pubmed ID | 10565547 |
Domain | CDD:294511 |
Functional Category | Others |
Uniprot ID | P72267 |
ORF Length (Amino Acid) | 98 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 28036 | 28323 | - | NZ_AP023173.1 | Rhodococcus qingshengii |
2 | 477835 | 478104 | - | NZ_LS483468.1 | Rhodococcus coprophilus |
3 | 2811730 | 2811987 | + | NZ_LT906450.1 | Rhodococcus rhodochrous |
4 | 3138548 | 3138802 | + | NZ_CP022208.1 | Rhodococcus pyridinivorans |
5 | 2664582 | 2664854 | + | NZ_CP027793.1 | Rhodococcus hoagii |
6 | 3242625 | 3242900 | - | NZ_AP023172.1 | Rhodococcus qingshengii |
7 | 4492255 | 4492521 | - | NZ_CP015235.1 | Rhodococcus fascians D188 |
8 | 6080859 | 6081122 | - | NZ_AP022596.1 | Mycolicibacterium helvum |
9 | 1080006 | 1080266 | + | NZ_CP033972.1 | Gordonia insulae |
10 | 2227574 | 2227828 | - | NZ_AP022581.1 | Mycobacterium lacus |
11 | 2636847 | 2637110 | + | NZ_AP022561.1 | Mycolicibacterium aichiense |
12 | 2086750 | 2087049 | + | NC_015564.1 | Hoyosella subflava DQS3-9A1 |
13 | 4130536 | 4130799 | - | NZ_AP022595.1 | Mycolicibacterium sarraceniae |
14 | 2188083 | 2188364 | + | NZ_CP009360.4 | Mycobacterium avium subsp. hominissuis |
15 | 1918120 | 1918401 | - | NZ_AP022582.1 | Mycobacterium seoulense |
16 | 3595465 | 3595719 | + | NZ_AP023396.1 | Nocardia wallacei |
17 | 2400848 | 2401126 | + | NC_016948.1 | Mycobacterium paraintracellulare |
18 | 2841249 | 2841506 | + | NZ_CP041695.1 | Nocardia otitidiscaviarum |
19 | 3660068 | 3660316 | - | NC_008726.1 | Mycolicibacterium vanbaalenii PYR-1 |
20 | 5517054 | 5517311 | - | NZ_AP022600.1 | Mycolicibacterium tokaiense |
21 | 3140504 | 3140758 | - | NZ_AP022618.1 | Mycolicibacterium insubricum |
22 | 3915292 | 3915555 | + | NZ_AP022598.1 | Mycolicibacterium parafortuitum |
23 | 418654 | 418902 | + | NZ_AP022565.1 | Mycolicibacterium alvei |
24 | 3664517 | 3664774 | - | NZ_CP011269.1 | Mycolicibacterium fortuitum |
25 | 2237477 | 2237746 | + | NZ_CP011853.1 | Gordonia phthalatica |
26 | 1464095 | 1464334 | - | NZ_CP033896.1 | Corynebacterium choanae |
27 | 2640008 | 2640277 | + | NC_013441.1 | Gordonia bronchialis DSM 43247 |
28 | 6328901 | 6329170 | - | NZ_CP031455.1 | Streptomyces olivoreticuli subsp. olivoreticuli |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00902.20 | 0.96 | 26 | 93 | same-strand | Sec-independent protein translocase protein (TatC) |
2 | PF02739.18 | 0.93 | 25 | 4744 | opposite-strand | 5'-3' exonuclease, N-terminal resolvase-like domain |
3 | PF01367.22 | 0.85 | 23 | 4732 | opposite-strand | 5'-3' exonuclease, C-terminal SAM fold |
4 | PF14230.8 | 0.93 | 25 | 3856 | same-strand | Domain of unknown function (DUF4333) |
5 | PF08148.14 | 0.96 | 26 | 1011 | same-strand | DSHCT (NUC185) domain |
6 | PF00270.31 | 0.96 | 26 | 1009.0 | same-strand | DEAD/DEAH box helicase |
7 | PF04851.17 | 0.96 | 26 | 1009.0 | same-strand | Type III restriction enzyme, res subunit |
8 | PF19187.2 | 0.96 | 26 | 93.5 | same-strand | PafC helix-turn-helix domain |
9 | PF13280.8 | 0.93 | 25 | 1030.5 | same-strand | WYL domain |
10 | PF03136.17 | 0.93 | 25 | 2137 | same-strand | Pup-ligase protein |