Result : P71622
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Antitoxin VapB22 |
| NCBI Accession ID | AL123456.3 |
| Organism | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) |
| Left | 3137009 |
| Right | 3137224 |
| Strand | - |
| Nucleotide Sequence | ATGACCGCTACGGAGGTGAAGGCGAAGATCCTCTCCTTGCTTGATGAAGTGGCCCAGGGCGAGGAGATCGAGATCACCAAACACGGCCGCACCGTGGCCCGGCTGGTGGCAGCGACGGGGCCGCACGCGCTGAAGGGTCGATTCTCGGGTGTGGCGATGGCGGCCGCGGATGACGACGAACTCTTCACCACCGGGGTTTCGTGGAACGTTTCATGA |
| Sequence | MTATEVKAKILSLLDEVAQGEEIEITKHGRTVARLVAATGPHALKGRFSGVAMAAADDDELFTTGVSWNVS |
| Source of smORF | Swiss-Prot |
| Function | Antitoxin component of a type II toxin-antitoxin (TA) system. Upon expression in M.smegmatis neutralizes the effect of cognate toxin VapC22. {ECO:0000269|Pubmed:20011113, ECO:0000305|Pubmed:15718296}. |
| Pubmed ID | 9634230 15718296 20011113 |
| Domain | CDD:415595 |
| Functional Category | Antitoxin_type_2 |
| Uniprot ID | P71622 |
| ORF Length (Amino Acid) | 71 |
++ More..
| Conservation Analysis |
No. of Species: 6
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3137009 | 3137224 | - | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
| 2 | 2391900 | 2392115 | - | NZ_AP022575.1 | Mycobacterium shinjukuense |
| 3 | 3195708 | 3195923 | - | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
| 4 | 2902656 | 2902871 | - | NZ_AP022581.1 | Mycobacterium lacus |
| 5 | 3481673 | 3481888 | + | NZ_AP022583.1 | Mycobacterium noviomagense |
| 6 | 4395116 | 4395331 | - | NZ_AP022613.1 | Mycobacterium conspicuum |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000962.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF08819.13 | 0.83 | 5 | 676 | same-strand | Domain of unknown function (DUF1802) |
| 2 | PF10041.11 | 0.67 | 4 | 410.0 | same-strand | Uncharacterized conserved protein (DUF2277) |
| 3 | PF01850.23 | 0.83 | 5 | -3.0 | same-strand | PIN domain |
| 4 | PF00378.22 | 0.83 | 5 | 47 | opposite-strand | Enoyl-CoA hydratase/isomerase |
++ More..