Result : P71376
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | RNA-binding protein HI_1333 |
| NCBI Accession ID | L42023.1 |
| Organism | Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) |
| Left | 1409576 |
| Right | 1409875 |
| Strand | - |
| Nucleotide Sequence | ATGACAACCTTATCAACCAAACAAAAACAATTTTTAAAAGGTCTTGCGCACCATCTTAACCCAGTCGTTATGCTTGGTGGAAATGGCTTAACCGAAGGTGTACTTGCTGAAATTGAAAATGCACTTAATCATCACGAACTCATTAAAGTAAAAGTTGCTGGTGCAGATCGTGAAACAAAACAACTTATTATCAATGCGATTGTGCGTGAAACTAAAGCAGCACAAGTACAAACTATCGGGCATATTTTGGTACTTTATCGCCCAAGCGAAGAAGCAAAAATTCAGCTTCCACGCAAATAA |
| Sequence | MTTLSTKQKQFLKGLAHHLNPVVMLGGNGLTEGVLAEIENALNHHELIKVKVAGADRETKQLIINAIVRETKAAQVQTIGHILVLYRPSEEAKIQLPRK |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00663. Profile Description: CRS1 / YhbY (CRM) domain. GFP fused to a single-domain CRM protein from maize localises to the nucleolus, suggesting that an analogous activity may have been retained in plants. A CRM domain containing protein in plant chloroplasts has been shown to function in group I and II intron splicing. In vitro experiments with an isolated maize CRM domain have shown it to have RNA binding activity. These and other results suggest that the CRM domain evolved in the context of ribosome function prior to the divergence of Archaea and Bacteria, that this function has been maintained in extant prokaryotes, and that the domain was recruited to serve as an RNA binding module during the evolution of plant genomes. YhbY has a fold similar to that of the C-terminal domain of translation initiation factor 3 (IF3C), which binds to 16S rRNA in the 30S ribosome. |
| Pubmed ID | 7542800 12360533 |
| Domain | CDD:412505 |
| Functional Category | RNA-binding |
| Uniprot ID | P71376 |
| ORF Length (Amino Acid) | 99 |
++ More..
| Conservation Analysis |
No. of Species: 368
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1478125 | 1478424 | + | NZ_CP009610.1 | Haemophilus influenzae |
| 2 | 1564639 | 1564938 | + | NZ_LS483429.1 | Haemophilus aegyptius |
| 3 | 1361376 | 1361675 | - | NZ_LS483458.1 | Haemophilus haemolyticus |
| 4 | 1863031 | 1863330 | + | NZ_LT906463.1 | Haemophilus pittmaniae |
| 5 | 457969 | 458268 | + | NZ_CP040863.1 | Rodentibacter heylii |
| 6 | 1326338 | 1326634 | - | NZ_LR134167.1 | Avibacterium volantium |
| 7 | 938067 | 938369 | - | NC_006300.1 | [Mannheimia] succiniciproducens MBEL55E |
| 8 | 757437 | 757682 | + | NZ_CP006954.1 | Bibersteinia trehalosi USDA-ARS-USMARC-188 |
| 9 | 1986824 | 1987126 | - | NZ_CP028926.1 | Pasteurella multocida |
| 10 | 1620247 | 1620492 | + | NC_021883.1 | Mannheimia haemolytica USMARC_2286 |
| 11 | 566474 | 566776 | - | NZ_CP015031.1 | Basfia succiniciproducens |
| 12 | 980355 | 980651 | + | NZ_CP018804.1 | Histophilus somni |
| 13 | 1744747 | 1745049 | + | NZ_LR134327.1 | Aggregatibacter aphrophilus ATCC 33389 |
| 14 | 970708 | 970950 | + | NC_011852.1 | Glaesserella parasuis SH0165 |
| 15 | 423670 | 423963 | + | NZ_LR134510.1 | Actinobacillus delphinicola |
| 16 | 1390527 | 1390796 | + | NZ_CP029206.1 | Actinobacillus porcitonsillarum |
| 17 | 1334198 | 1334500 | - | NZ_LS483443.1 | Aggregatibacter segnis ATCC 33393 |
| 18 | 1251555 | 1251797 | - | NZ_CP061280.1 | Mannheimia bovis |
| 19 | 544419 | 544736 | - | NZ_CP007715.1 | Actinobacillus equuli subsp. equuli |
| 20 | 547262 | 547579 | - | NZ_CP009159.1 | Actinobacillus suis ATCC 33415 |
| 21 | 491185 | 491502 | - | NZ_CP030753.1 | Actinobacillus pleuropneumoniae |
| 22 | 706672 | 706974 | - | NZ_LT906448.1 | Pasteurella dagmatis |
| 23 | 1323973 | 1324215 | + | NZ_CP006944.1 | Mannheimia varigena USDA-ARS-USMARC-1312 |
| 24 | 1716496 | 1716738 | + | NZ_CP046531.1 | Mannheimia ovis |
| 25 | 1801135 | 1801377 | + | NZ_CP055305.1 | Mannheimia pernigra |
| 26 | 852392 | 852688 | - | NZ_CP016605.1 | Bisgaardia hudsonensis |
| 27 | 1379025 | 1379270 | + | NZ_CP015029.1 | Frederiksenia canicola |
| 28 | 1490241 | 1490486 | - | NZ_CP015425.1 | [Haemophilus] ducreyi |
| 29 | 1258613 | 1258855 | + | NZ_CP016180.1 | Pasteurella skyensis |
| 30 | 1206108 | 1206350 | - | NZ_CP016604.1 | Otariodibacter oris |
| 31 | 230172 | 230465 | - | NZ_CP015581.1 | Tatumella citrea |
| 32 | 1011669 | 1011965 | - | NC_008709.1 | Psychromonas ingrahamii 37 |
| 33 | 443421 | 443714 | - | NZ_CP034148.1 | Pantoea agglomerans |
| 34 | 3627058 | 3627351 | + | NZ_CP038853.1 | Pantoea vagans |
| 35 | 2307811 | 2308104 | + | NZ_CP036536.1 | Salinimonas lutimaris |
| 36 | 3654511 | 3654804 | + | NZ_CP045720.1 | Pantoea eucalypti |
| 37 | 1108681 | 1108977 | - | NC_013456.1 | Vibrio antiquarius |
| 38 | 2937127 | 2937423 | - | NZ_CP025792.1 | Vibrio jasicida 090810c |
| 39 | 1923737 | 1923991 | - | NZ_CP031769.1 | Salinimonas sediminis |
| 40 | 682904 | 683200 | - | NZ_CP031781.1 | Vibrio parahaemolyticus |
| 41 | 1904433 | 1904729 | - | NZ_CP014056.2 | Grimontia hollisae |
| 42 | 780855 | 781121 | - | NZ_AP018685.1 | Vibrio rumoiensis |
| 43 | 654632 | 654877 | - | NZ_CP046268.1 | Vibrio spartinae |
| 44 | 336087 | 336383 | - | NZ_CP009977.1 | Vibrio natriegens NBRC 15636 = ATCC 14048 = DSM 759 |
| 45 | 2565433 | 2565729 | + | NZ_CP030788.1 | Vibrio campbellii |
| 46 | 2515472 | 2515768 | - | NZ_CP019959.1 | Vibrio owensii |
| 47 | 3129134 | 3129430 | + | NZ_CP009467.1 | Vibrio harveyi |
| 48 | 4062000 | 4062293 | + | NC_017554.1 | Pantoea ananatis PA13 |
| 49 | 663350 | 663646 | - | NZ_CP032093.1 | Vibrio alfacsensis |
| 50 | 1774300 | 1774593 | - | NZ_LT556085.1 | Citrobacter amalonaticus |
| 51 | 5350895 | 5351188 | + | NZ_CP045205.1 | Citrobacter telavivensis |
| 52 | 2474063 | 2474326 | + | NC_012691.1 | Tolumonas auensis DSM 9187 |
| 53 | 1851630 | 1851926 | + | NZ_AP018689.1 | Vibrio aphrogenes |
| 54 | 2532171 | 2532467 | + | NZ_CP047475.1 | Vibrio astriarenae |
| 55 | 4479520 | 4479813 | + | NC_014306.1 | Erwinia billingiae Eb661 |
| 56 | 567796 | 568041 | - | NZ_CP022741.1 | Vibrio qinghaiensis |
| 57 | 1396925 | 1397224 | - | NZ_CP028897.1 | Dongshaea marina |
| 58 | 2090607 | 2090903 | - | NZ_CP065150.1 | Vibrio kanaloae |
| 59 | 2664428 | 2664724 | + | NC_011753.2 | Vibrio atlanticus |
| 60 | 618640 | 618936 | - | NZ_CP039700.1 | Vibrio cyclitrophicus |
| 61 | 3345442 | 3345735 | - | NZ_CP049115.1 | Pantoea stewartii |
| 62 | 474788 | 475084 | - | NZ_CP018312.1 | Vibrio rotiferianus |
| 63 | 474738 | 475031 | - | NZ_CP012264.1 | Cronobacter condimenti 1330 |
| 64 | 3764754 | 3765053 | + | NC_009901.1 | Shewanella pealeana ATCC 700345 |
| 65 | 3852992 | 3853291 | + | NC_010334.1 | Shewanella halifaxensis HAW-EB4 |
| 66 | 3593102 | 3593398 | + | NZ_CP005974.1 | Photobacterium gaetbulicola Gung47 |
| 67 | 2413494 | 2413751 | - | NZ_CP046793.1 | Vibrio metschnikovii |
| 68 | 593617 | 593919 | - | NZ_CP051180.1 | Ferrimonas lipolytica |
| 69 | 540962 | 541255 | - | NZ_LN907827.1 | Erwinia gerundensis |
| 70 | 1499103 | 1499396 | + | NZ_CP014322.1 | Alteromonas addita |
| 71 | 2129537 | 2129830 | + | NC_015554.1 | Alteromonas naphthalenivorans |
| 72 | 1662540 | 1662836 | + | NZ_LT960611.1 | Vibrio tapetis subsp. tapetis |
| 73 | 506501 | 506794 | - | NZ_CP054058.1 | Scandinavium goeteborgense |
| 74 | 490830 | 491084 | - | NZ_CP034035.1 | Brenneria rubrifaciens |
| 75 | 651666 | 651962 | - | NC_011312.1 | Aliivibrio salmonicida LFI1238 |
| 76 | 279491 | 279787 | - | NZ_CP009056.1 | Frischella perrara |
| 77 | 2904707 | 2905003 | + | NZ_CP070624.1 | Photobacterium damselae subsp. damselae |
| 78 | 2967416 | 2967709 | + | NZ_CP027107.1 | Cronobacter sakazakii |
| 79 | 3691851 | 3692144 | + | NZ_CP013940.1 | Cronobacter malonaticus LMG 23826 |
| 80 | 3567134 | 3567427 | + | NZ_CP012268.1 | Cronobacter muytjensii ATCC 51329 |
| 81 | 566536 | 566829 | - | NZ_CP045845.1 | Kluyvera intermedia |
| 82 | 1322436 | 1322729 | + | NZ_CP053416.1 | Salmonella bongori |
| 83 | 1137462 | 1137761 | - | NC_007954.1 | Shewanella denitrificans OS217 |
| 84 | 3070534 | 3070794 | - | NZ_CP021377.1 | Oceanisphaera profunda |
| 85 | 1026003 | 1026302 | - | NZ_CP069213.1 | Shewanella litorisediminis |
| 86 | 1152075 | 1152374 | - | NC_008700.1 | Shewanella amazonensis SB2B |
| 87 | 3467488 | 3467781 | + | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 88 | 459564 | 459857 | - | NZ_CP012257.1 | Cronobacter universalis NCTC 9529 |
| 89 | 1214841 | 1215089 | - | NC_011566.1 | Shewanella piezotolerans WP3 |
| 90 | 609499 | 609795 | - | NZ_CP040449.1 | Aeromonas simiae |
| 91 | 4894669 | 4894962 | - | NC_013716.1 | Citrobacter rodentium ICC168 |
| 92 | 2864434 | 2864730 | + | NZ_CP071325.1 | Photobacterium ganghwense |
| 93 | 539263 | 539556 | - | NZ_CP050508.1 | Raoultella terrigena |
| 94 | 3383656 | 3383949 | - | NZ_CP072133.1 | Pseudoalteromonas xiamenensis |
| 95 | 1898339 | 1898632 | + | NZ_AP019007.1 | Enterobacter oligotrophicus |
| 96 | 4074318 | 4074611 | + | NZ_AP022508.1 | Enterobacter bugandensis |
| 97 | 4149399 | 4149692 | + | NZ_CP027986.1 | Enterobacter sichuanensis |
| 98 | 3141780 | 3142073 | - | NZ_CP025034.2 | Enterobacter sp. SGAir0187 |
| 99 | 4238751 | 4239044 | - | NZ_CP017279.1 | Enterobacter ludwigii |
| 100 | 559322 | 559621 | - | NZ_CP020373.1 | Shewanella khirikhana |
| 101 | 1951247 | 1951540 | - | NZ_CP046670.1 | Alteromonas mediterranea |
| 102 | 3301805 | 3302059 | + | NZ_CP015749.1 | Pectobacterium parmentieri |
| 103 | 2529072 | 2529326 | - | NZ_CP015750.1 | Pectobacterium wasabiae CFBP 3304 |
| 104 | 744193 | 744447 | - | NZ_CP038498.1 | Pectobacterium punjabense |
| 105 | 4018955 | 4019248 | + | NZ_CP034036.1 | Brenneria nigrifluens DSM 30175 = ATCC 13028 |
| 106 | 4163285 | 4163578 | + | NZ_CP017184.1 | Enterobacter roggenkampii |
| 107 | 4160256 | 4160549 | + | NC_015968.1 | Enterobacter soli |
| 108 | 4188112 | 4188405 | - | NZ_CP045769.1 | Enterobacter cancerogenus |
| 109 | 577241 | 577534 | - | NZ_CP013990.1 | Leclercia adecarboxylata |
| 110 | 1951984 | 1952277 | - | NZ_CP065640.1 | Serratia rubidaea |
| 111 | 520688 | 520981 | - | NZ_CP041247.1 | Raoultella electrica |
| 112 | 1152111 | 1152404 | + | NZ_CP026047.1 | Raoultella planticola |
| 113 | 571012 | 571305 | - | NZ_CP046672.1 | Raoultella ornithinolytica |
| 114 | 622538 | 622831 | - | NZ_CP060111.1 | Klebsiella michiganensis |
| 115 | 4030161 | 4030457 | - | NZ_CP052766.1 | Alteromonas pelagimontana |
| 116 | 518539 | 518835 | - | NZ_CP009354.1 | Vibrio tubiashii ATCC 19109 |
| 117 | 4231171 | 4231464 | + | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
| 118 | 4503297 | 4503590 | + | NZ_CP043318.1 | Enterobacter chengduensis |
| 119 | 2634835 | 2635131 | - | NZ_CP041660.1 | Catenovulum sediminis |
| 120 | 3661901 | 3662194 | - | NZ_CP045300.1 | Kosakonia arachidis |
| 121 | 528964 | 529257 | - | NZ_LR134475.1 | Klebsiella aerogenes |
| 122 | 532815 | 533108 | - | NZ_CP065838.1 | Klebsiella quasipneumoniae |
| 123 | 4746902 | 4747195 | + | NC_016845.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
| 124 | 546531 | 546824 | - | NZ_CP054254.1 | Klebsiella variicola |
| 125 | 4611533 | 4611832 | + | NZ_CP037952.1 | Parashewanella spongiae |
| 126 | 3577195 | 3577488 | + | NZ_CP023567.1 | Erwinia pyrifoliae |
| 127 | 508200 | 508493 | - | NZ_CP061511.1 | Mixta calida |
| 128 | 4347524 | 4347817 | - | NZ_CP028271.1 | Mixta intestinalis |
| 129 | 939750 | 940004 | + | NZ_CP047495.1 | Pectobacterium brasiliense |
| 130 | 4132449 | 4132703 | + | NZ_CP051652.1 | Pectobacterium carotovorum |
| 131 | 648943 | 649197 | - | NZ_CP009125.1 | Pectobacterium atrosepticum |
| 132 | 4233588 | 4233842 | + | NZ_CP065044.1 | Pectobacterium aroidearum |
| 133 | 683128 | 683382 | - | NZ_CP034938.1 | Pectobacterium odoriferum |
| 134 | 4521020 | 4521274 | - | NZ_CP017482.1 | Pectobacterium polaris |
| 135 | 471663 | 471956 | - | NZ_CP012266.1 | Cronobacter dublinensis subsp. dublinensis LMG 23823 |
| 136 | 2030870 | 2031163 | - | NZ_CP008849.1 | Alteromonas australica |
| 137 | 4845506 | 4845754 | + | NZ_CP014782.1 | Shewanella psychrophila |
| 138 | 4269261 | 4269554 | + | NZ_CP009756.1 | Enterobacter cloacae |
| 139 | 1131543 | 1131836 | + | NZ_CP042941.1 | Atlantibacter hermannii |
| 140 | 4069675 | 4069968 | + | NZ_CP012871.1 | [Enterobacter] lignolyticus |
| 141 | 2590600 | 2590893 | + | NZ_CP016337.1 | Kosakonia sacchari |
| 142 | 4340666 | 4340959 | + | NZ_CP063425.1 | Kosakonia pseudosacchari |
| 143 | 555883 | 556176 | - | NZ_CP014007.2 | Kosakonia oryzae |
| 144 | 4768092 | 4768385 | + | NZ_CP015113.1 | Kosakonia radicincitans |
| 145 | 395537 | 395779 | - | NC_010694.1 | Erwinia tasmaniensis Et1/99 |
| 146 | 508975 | 509268 | - | NZ_AP023184.1 | Buttiauxella agrestis |
| 147 | 3741687 | 3741935 | + | NC_014012.1 | Shewanella violacea DSS12 |
| 148 | 1095740 | 1096033 | - | NZ_CP051548.1 | Phytobacter diazotrophicus |
| 149 | 5258543 | 5258836 | - | NZ_CP011602.1 | Phytobacter ursingii |
| 150 | 395402 | 395695 | - | NC_013961.1 | Erwinia amylovora CFBP1430 |
| 151 | 661155 | 661448 | - | NZ_CP036175.1 | Klebsiella huaxiensis |
| 152 | 3682013 | 3682312 | + | NZ_CP046378.1 | Shewanella algae |
| 153 | 1547775 | 1548068 | - | NZ_CP013187.1 | Pseudoalteromonas phenolica |
| 154 | 3311361 | 3311654 | + | NZ_AP014857.1 | Escherichia albertii |
| 155 | 342135 | 342428 | - | NZ_CP023525.1 | Cedecea neteri |
| 156 | 1041348 | 1041644 | - | NZ_CP012621.1 | Zobellella denitrificans |
| 157 | 603535 | 603828 | + | NZ_CP040428.1 | Jejubacter calystegiae |
| 158 | 4158813 | 4159109 | - | NZ_CP067057.1 | Rahnella aceris |
| 159 | 3945751 | 3946044 | - | NZ_CP038469.1 | Citrobacter tructae |
| 160 | 2947695 | 2947988 | - | NZ_CP044098.1 | Citrobacter portucalensis |
| 161 | 2133484 | 2133777 | + | NZ_CP033744.1 | Citrobacter freundii |
| 162 | 3539107 | 3539400 | + | NZ_CP014137.1 | Brenneria goodwinii |
| 163 | 327318 | 327611 | + | NZ_CP020388.1 | Pluralibacter gergoviae |
| 164 | 345370 | 345663 | - | NZ_LR134201.1 | Cedecea lapagei |
| 165 | 2901184 | 2901480 | - | NZ_CP072425.1 | Pseudoalteromonas viridis |
| 166 | 3493170 | 3493412 | + | NZ_CP041036.1 | Shewanella polaris |
| 167 | 185011 | 185307 | - | NZ_CP014035.2 | Vibrio fluvialis |
| 168 | 3153511 | 3153807 | + | NZ_CP040990.1 | Vibrio furnissii |
| 169 | 1083105 | 1083398 | + | NZ_CP019706.1 | Pantoea alhagi |
| 170 | 1851588 | 1851884 | - | NZ_CP026364.1 | Proteus hauseri |
| 171 | 3833090 | 3833383 | + | NZ_LR134340.1 | Escherichia marmotae |
| 172 | 2252601 | 2252894 | + | NZ_CP057657.1 | Escherichia fergusonii |
| 173 | 3319972 | 3320265 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 174 | 3327790 | 3328083 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 175 | 4070416 | 4070709 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 176 | 2344938 | 2345234 | + | NZ_CP033078.1 | Vibrio zhugei |
| 177 | 3242055 | 3242357 | + | NC_014541.1 | Ferrimonas balearica DSM 9799 |
| 178 | 4611474 | 4611770 | - | NZ_CP051883.1 | Aeromonas salmonicida |
| 179 | 3770708 | 3771004 | + | NZ_CP050851.1 | Aeromonas hydrophila |
| 180 | 1519230 | 1519529 | - | NZ_CP034015.1 | Shewanella livingstonensis |
| 181 | 276493 | 276789 | - | NZ_CP047349.1 | Proteus terrae subsp. cibarius |
| 182 | 1310265 | 1310525 | + | NZ_CP036200.1 | Shewanella maritima |
| 183 | 2325553 | 2325849 | + | NZ_CP040021.1 | Salinivibrio kushneri |
| 184 | 1109658 | 1109918 | + | NZ_CP021376.1 | Oceanisphaera avium |
| 185 | 587512 | 587805 | - | NZ_CP026377.1 | Mixta gaviniae |
| 186 | 2865784 | 2866077 | + | NZ_CP023529.1 | Lelliottia amnigena |
| 187 | 1685090 | 1685383 | - | NZ_CP023009.1 | Lonsdalea britannica |
| 188 | 3581529 | 3581828 | + | NZ_CP022358.1 | Shewanella bicestrii |
| 189 | 676342 | 676596 | - | NZ_CP031560.1 | Dickeya dianthicola |
| 190 | 2837015 | 2837308 | - | NZ_CP015137.1 | Dickeya solani IPO 2222 |
| 191 | 667230 | 667523 | - | NC_014500.1 | Dickeya dadantii 3937 |
| 192 | 2116079 | 2116372 | + | NZ_CP009460.1 | Dickeya fangzhongdai |
| 193 | 4358761 | 4359060 | + | NC_010506.1 | Shewanella woodyi ATCC 51908 |
| 194 | 2027275 | 2027529 | + | NZ_CP014136.1 | Gibbsiella quercinecans |
| 195 | 4141790 | 4142089 | + | NC_009831.1 | Shewanella sediminis HAW-EB3 |
| 196 | 1146836 | 1147135 | - | NC_008345.1 | Shewanella frigidimarina NCIMB 400 |
| 197 | 4619064 | 4619357 | + | NZ_CP071320.1 | Serratia ureilytica |
| 198 | 4887390 | 4887683 | - | NZ_CP016948.1 | Serratia surfactantfaciens |
| 199 | 548985 | 549278 | - | NZ_LT906479.1 | Serratia ficaria |
| 200 | 416709 | 417002 | - | NZ_CP038662.1 | Serratia nematodiphila |
| 201 | 406452 | 406745 | - | NZ_CP048784.1 | Serratia liquefaciens |
| 202 | 407175 | 407468 | - | NZ_LR134494.1 | Serratia quinivorans |
| 203 | 467620 | 467874 | - | NC_015567.1 | Serratia plymuthica AS9 |
| 204 | 515075 | 515368 | - | NZ_CP035129.1 | Kosakonia cowanii |
| 205 | 3992434 | 3992733 | + | NC_016901.1 | Shewanella baltica OS678 |
| 206 | 526616 | 526873 | - | NZ_AP014524.1 | Vibrio cholerae MS6 |
| 207 | 3700631 | 3700924 | + | NZ_CP042220.2 | Dickeya poaceiphila |
| 208 | 654055 | 654348 | - | NZ_CP025799.1 | Dickeya zeae |
| 209 | 3947258 | 3947551 | + | NC_012912.1 | Dickeya chrysanthemi Ech1591 |
| 210 | 282472 | 282729 | - | NZ_CP035688.1 | Vibrio metoecus |
| 211 | 2717987 | 2718283 | + | NZ_CP044069.1 | Vibrio vulnificus |
| 212 | 2364298 | 2364594 | + | NZ_CP032090.1 | Pseudoalteromonas donghaensis |
| 213 | 1102095 | 1102391 | - | NZ_CP011039.1 | Pseudoalteromonas spongiae UST010723-006 |
| 214 | 1820248 | 1820544 | - | NZ_CP009888.1 | Pseudoalteromonas piratica |
| 215 | 488631 | 488924 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 216 | 1343598 | 1343891 | - | NZ_CP023536.1 | Providencia alcalifaciens |
| 217 | 2447725 | 2448021 | + | NZ_CP016414.1 | Vibrio scophthalmi |
| 218 | 208538 | 208834 | - | NZ_AP019657.1 | Vibrio ponticus |
| 219 | 3928430 | 3928684 | + | NC_012880.1 | Musicola paradisiaca Ech703 |
| 220 | 408853 | 409146 | - | NC_017910.1 | Shimwellia blattae DSM 4481 = NBRC 105725 |
| 221 | 2173650 | 2173904 | - | NZ_CP006664.1 | Edwardsiella anguillarum ET080813 |
| 222 | 4156357 | 4156653 | - | NZ_CP044060.1 | Aeromonas veronii |
| 223 | 2615893 | 2616189 | + | NZ_CP065745.1 | Aeromonas allosaccharophila |
| 224 | 688708 | 688962 | - | NZ_LT615367.1 | Dickeya aquatica |
| 225 | 1117143 | 1117439 | - | NZ_AP022188.1 | Aeromonas media |
| 226 | 3736381 | 3736677 | - | NC_010554.1 | Proteus mirabilis HI4320 |
| 227 | 1159852 | 1160151 | - | NZ_CP022272.1 | Shewanella marisflavi |
| 228 | 3361723 | 3362022 | + | NC_009092.1 | Shewanella loihica PV-4 |
| 229 | 2371782 | 2372075 | - | NZ_CP011254.1 | Serratia fonticola |
| 230 | 237847 | 238089 | + | NZ_CP007044.2 | Chania multitudinisentens RB-25 |
| 231 | 2592190 | 2592435 | + | NZ_CP045350.1 | Vibrio aquimaris |
| 232 | 4028265 | 4028537 | + | NZ_CP072455.1 | Xenorhabdus budapestensis |
| 233 | 3968221 | 3968514 | + | NZ_CP006569.1 | Sodalis praecaptivus |
| 234 | 3303094 | 3303348 | + | NZ_CP016043.1 | Edwardsiella hoshinae |
| 235 | 3928894 | 3929187 | + | NZ_CP048796.1 | Providencia vermicola |
| 236 | 2408017 | 2408313 | + | NZ_CP011041.1 | Pseudoalteromonas tetraodonis |
| 237 | 2381730 | 2382026 | + | NZ_CP011030.1 | Pseudoalteromonas issachenkonii |
| 238 | 2863984 | 2864277 | - | NZ_CP007445.1 | Gilliamella apicola |
| 239 | 2301599 | 2301844 | + | NC_016041.1 | Glaciecola nitratireducens FR1064 |
| 240 | 1074593 | 1074889 | - | NZ_CP029347.1 | Saliniradius amylolyticus |
| 241 | 3010075 | 3010368 | + | NZ_CP060401.1 | Xenorhabdus nematophila |
| 242 | 3948166 | 3948408 | + | NZ_LS483422.1 | Providencia heimbachae |
| 243 | 3384076 | 3384375 | + | NZ_CP037951.1 | Parashewanella tropica |
| 244 | 1057338 | 1057634 | - | NZ_LR134376.1 | Aeromonas encheleia |
| 245 | 3241681 | 3241974 | + | NZ_LS483470.1 | Leminorella richardii |
| 246 | 1274530 | 1274784 | + | NZ_CP023706.1 | Edwardsiella tarda |
| 247 | 558872 | 559126 | - | NZ_CP050150.1 | Hafnia alvei |
| 248 | 1067061 | 1067357 | - | NZ_CP033065.1 | Pseudoalteromonas agarivorans |
| 249 | 2592423 | 2592719 | + | NZ_CP023464.1 | Pseudoalteromonas atlantica |
| 250 | 1136771 | 1137067 | - | NZ_CP011028.1 | Pseudoalteromonas espejiana DSM 9414 |
| 251 | 3211992 | 3212246 | + | NZ_CP065534.1 | Lonsdalea populi |
| 252 | 457247 | 457501 | - | NC_012779.2 | Edwardsiella ictaluri 93-146 |
| 253 | 453610 | 453903 | - | NZ_LR134531.1 | Pragia fontium |
| 254 | 2540714 | 2541010 | + | NZ_CP027523.1 | Pseudoalteromonas carrageenovora |
| 255 | 2898599 | 2898895 | + | NZ_AP014635.1 | Vibrio tritonius |
| 256 | 3339459 | 3339752 | + | NZ_FO704551.1 | Xenorhabdus poinarii G6 |
| 257 | 366231 | 366503 | - | NC_013892.1 | Xenorhabdus bovienii SS-2004 |
| 258 | 894707 | 895003 | - | NC_007481.1 | Pseudoalteromonas translucida |
| 259 | 958737 | 959033 | - | NZ_CP011036.1 | Pseudoalteromonas nigrifaciens |
| 260 | 1126726 | 1127019 | - | NZ_CP029736.1 | Providencia rettgeri |
| 261 | 3413498 | 3413791 | + | NZ_CP031123.2 | Providencia huaxiensis |
| 262 | 441956 | 442249 | - | NZ_FO704550.1 | Xenorhabdus doucetiae |
| 263 | 534993 | 535286 | - | NZ_CP029185.2 | Limnobaculum parvum |
| 264 | 510007 | 510300 | - | NZ_CP034752.1 | Jinshanibacter zhutongyuii |
| 265 | 2995750 | 2996043 | + | NZ_CP016176.1 | Xenorhabdus hominickii |
| 266 | 2649204 | 2649458 | - | NZ_CP011078.1 | Yersinia ruckeri |
| 267 | 1993032 | 1993331 | + | NZ_CP041783.1 | Shewanella donghaensis |
| 268 | 1128140 | 1128436 | - | NZ_CP011025.1 | Pseudoalteromonas arctica A 37-1-2 |
| 269 | 566819 | 567115 | - | NZ_CP031961.1 | Pseudoalteromonas tunicata |
| 270 | 3207935 | 3208228 | - | NZ_CP009781.1 | Yersinia aldovae 670-83 |
| 271 | 3394390 | 3394644 | - | NZ_CP009787.1 | Yersinia rohdei |
| 272 | 1795949 | 1796203 | - | NZ_CP054043.1 | Yersinia mollaretii ATCC 43969 |
| 273 | 561116 | 561370 | - | NZ_CP043727.1 | Yersinia canariae |
| 274 | 4177813 | 4178106 | + | NZ_CP011118.1 | Yersinia enterocolitica |
| 275 | 498306 | 498560 | - | NZ_CP032487.1 | Yersinia hibernica |
| 276 | 4165125 | 4165379 | + | NZ_CP046293.1 | Yersinia intermedia |
| 277 | 4019870 | 4020124 | + | NZ_LR134373.1 | Yersinia pseudotuberculosis |
| 278 | 2200012 | 2200266 | - | NZ_CP007230.1 | Yersinia similis |
| 279 | 3760597 | 3760896 | + | NZ_CP020472.1 | Shewanella japonica |
| 280 | 4479926 | 4480222 | + | NZ_CP019628.1 | Pseudoalteromonas aliena |
| 281 | 1731827 | 1732123 | - | NZ_CP017689.1 | Thalassotalea crassostreae |
| 282 | 5299591 | 5299884 | + | NC_005126.1 | Photorhabdus laumondii subsp. laumondii TTO1 |
| 283 | 2387538 | 2387810 | - | NZ_CP011104.1 | Photorhabdus thracensis |
| 284 | 1349042 | 1349338 | - | NZ_CP020465.1 | Cognaticolwellia beringensis |
| 285 | 4702918 | 4703190 | + | NC_012962.1 | Photorhabdus asymbiotica |
| 286 | 56603 | 56899 | - | NZ_CP034759.1 | Litorilituus sediminis |
| 287 | 1032454 | 1032750 | + | NC_006512.1 | Idiomarina loihiensis L2TR |
| 288 | 3589633 | 3589929 | + | NC_003910.7 | Colwellia psychrerythraea 34H |
| 289 | 58034 | 58330 | - | NZ_CP044399.1 | Moritella marina ATCC 15381 |
| 290 | 2763558 | 2763812 | + | NZ_CP031416.1 | Gallaecimonas mangrovi |
| 291 | 3857112 | 3857408 | - | NZ_LS483250.1 | Moritella yayanosii |
| 292 | 2540338 | 2540637 | + | NZ_CP072844.1 | Psychrosphaera aestuarii |
| 293 | 913688 | 913981 | - | NZ_CP022355.1 | Paraphotobacterium marinum |
| 294 | 2371342 | 2371638 | + | NZ_CP025120.1 | Kangiella profundi |
| 295 | 249630 | 249926 | - | NZ_CP012418.1 | Kangiella sediminilitoris |
| 296 | 2566691 | 2566987 | + | NC_013166.1 | Kangiella koreensis DSM 16069 |
| 297 | 220271 | 220582 | - | NZ_CP010975.1 | Kangiella geojedonensis |
| 298 | 2035121 | 2035378 | + | NZ_CP046415.1 | Guyparkeria halophila |
| 299 | 1959984 | 1960238 | - | NC_017857.3 | Methylophaga nitratireducenticrescens |
| 300 | 4262224 | 4262517 | + | NZ_CP011129.1 | Lysobacter antibioticus |
| 301 | 4286237 | 4286542 | + | NZ_AP014940.1 | Lysobacter enzymogenes |
| 302 | 4272966 | 4273214 | + | NZ_AP019312.1 | Chromobacterium haemolyticum |
| 303 | 4157962 | 4158255 | + | NZ_CP023465.1 | Lysobacter capsici |
| 304 | 1692089 | 1692394 | - | NZ_CP011131.1 | Lysobacter gummosus |
| 305 | 1213417 | 1213722 | - | NZ_CP046603.1 | Lysobacter soli |
| 306 | 2679911 | 2680216 | + | NZ_CP029843.1 | Lysobacter maris |
| 307 | 834460 | 834708 | + | NZ_CP029495.1 | Chromobacterium phragmitis |
| 308 | 2105312 | 2105560 | + | NZ_CP017707.1 | Chromobacterium vaccinii |
| 309 | 1864372 | 1864614 | + | NC_012968.1 | Methylotenera mobilis JLW8 |
| 310 | 2915246 | 2915494 | + | NZ_CP043473.1 | Chromobacterium paludis |
| 311 | 4097026 | 4097271 | + | NC_005085.1 | Chromobacterium violaceum ATCC 12472 |
| 312 | 1701825 | 1702130 | - | NZ_CP033326.1 | Xanthomonas cucurbitae |
| 313 | 2942678 | 2942992 | - | NZ_CP037953.1 | Permianibacter aggregans |
| 314 | 2540036 | 2540341 | + | NZ_LT853882.1 | Xanthomonas fragariae |
| 315 | 1263718 | 1264038 | - | NZ_CP041242.1 | Lysobacter alkalisoli |
| 316 | 2917104 | 2917409 | + | NZ_CP028127.1 | Xanthomonas vasicola pv. vasculorum |
| 317 | 5039395 | 5039700 | - | NZ_CP018725.1 | Xanthomonas vesicatoria ATCC 35937 |
| 318 | 2921735 | 2922040 | + | NZ_CP058243.1 | Xanthomonas campestris pv. raphani |
| 319 | 1852116 | 1852376 | - | NZ_CP039731.1 | Aquitalea aquatilis |
| 320 | 2876832 | 2877122 | + | NZ_CP038033.1 | Nitrosococcus wardiae |
| 321 | 865079 | 865405 | - | NZ_CP030880.1 | Acinetobacter haemolyticus |
| 322 | 860530 | 860853 | - | NZ_CP044483.1 | Acinetobacter schindleri |
| 323 | 2383448 | 2383771 | + | NZ_CP024632.1 | Acinetobacter junii |
| 324 | 473071 | 473376 | - | NZ_CP016878.1 | Xanthomonas hortorum |
| 325 | 2792708 | 2793034 | + | NC_005966.1 | Acinetobacter baylyi ADP1 |
| 326 | 39302 | 39628 | - | NZ_CP041970.1 | Acinetobacter dispersus |
| 327 | 3705509 | 3705769 | + | NZ_CP047241.1 | Aquitalea denitrificans |
| 328 | 2303724 | 2304047 | + | NC_016603.1 | Acinetobacter pittii PHEA-2 |
| 329 | 867500 | 867823 | - | NZ_CP065820.1 | Acinetobacter seifertii |
| 330 | 829710 | 830033 | - | NZ_CP053391.1 | Acinetobacter lactucae |
| 331 | 2789510 | 2789833 | - | NZ_CP070518.1 | Acinetobacter calcoaceticus |
| 332 | 2861313 | 2861636 | - | NZ_CP040105.1 | Acinetobacter nosocomialis M2 |
| 333 | 813009 | 813332 | - | NZ_CP015121.1 | Acinetobacter baumannii |
| 334 | 899967 | 900290 | - | NZ_CP049916.1 | Acinetobacter lanii |
| 335 | 2400453 | 2400758 | - | NZ_CP060820.1 | Lysobacter solisilvae (ex Woo and Kim 2020) |
| 336 | 2107020 | 2107313 | + | NZ_AP018560.1 | Aerosticca soli |
| 337 | 114074 | 114355 | + | NZ_LR134533.1 | Neisseria weaveri |
| 338 | 832826 | 833149 | - | NC_014259.1 | Acinetobacter oleivorans DR1 |
| 339 | 3419052 | 3419375 | + | NZ_AP014630.1 | Acinetobacter guillouiae |
| 340 | 1629425 | 1629709 | - | NZ_LR134378.1 | Lautropia mirabilis |
| 341 | 1495057 | 1495314 | + | NZ_CP059564.1 | Alysiella filiformis |
| 342 | 1150180 | 1150455 | - | NZ_CP038017.1 | Allofrancisella frigidaquae |
| 343 | 1027533 | 1027814 | + | NZ_CP009654.1 | Francisella frigiditurris |
| 344 | 1087118 | 1087399 | + | NZ_CP031700.1 | Neisseria zalophi |
| 345 | 2082297 | 2082548 | - | NZ_CP046027.1 | Neisseria brasiliensis |
| 346 | 49248 | 49499 | + | NZ_CP031699.1 | Neisseria animalis |
| 347 | 2094364 | 2094657 | - | NZ_CP019448.1 | Simonsiella muelleri ATCC 29453 |
| 348 | 424971 | 425216 | + | NZ_LS483369.1 | Neisseria cinerea |
| 349 | 1946154 | 1946444 | + | NC_008789.1 | Halorhodospira halophila SL1 |
| 350 | 934183 | 934428 | + | NZ_CP072524.1 | Neisseria sicca |
| 351 | 1758228 | 1758473 | + | NZ_CP031325.1 | Neisseria polysaccharea |
| 352 | 1533240 | 1533515 | - | NZ_CP010427.1 | Allofrancisella guangzhouensis |
| 353 | 532950 | 533225 | + | NZ_CP038241.1 | Allofrancisella inopinata |
| 354 | 1821601 | 1821879 | - | NC_015696.1 | Francisella salina |
| 355 | 3162052 | 3162318 | + | NZ_CP013742.1 | Legionella pneumophila |
| 356 | 1544727 | 1545005 | - | NZ_CP022132.1 | Francisella halioticida |
| 357 | 1664300 | 1664578 | - | NZ_CP016796.1 | Francisella uliginis |
| 358 | 1195948 | 1196196 | + | NZ_CP059569.1 | Kingella oralis |
| 359 | 313749 | 314027 | - | NZ_CP018800.1 | Mariprofundus ferrinatatus |
| 360 | 1232522 | 1232800 | - | NZ_CP043552.1 | Francisella marina |
| 361 | 2296198 | 2296482 | - | NZ_CP031252.1 | Neisseria elongata |
| 362 | 909701 | 909949 | + | NZ_CP039887.1 | Neisseria subflava |
| 363 | 1279408 | 1279686 | - | NC_017449.1 | Francisella hispaniensis |
| 364 | 837758 | 838006 | + | NZ_CP039886.1 | Neisseria flavescens |
| 365 | 585504 | 585782 | + | NC_023029.1 | Francisella orientalis LADL--07-285A |
| 366 | 1985875 | 1986156 | + | NC_002977.6 | Methylococcus capsulatus str. Bath |
| 367 | 1274137 | 1274415 | - | NZ_CP022375.1 | Francisella opportunistica |
| 368 | 1023496 | 1023762 | + | NZ_CP014476.1 | Methylomonas denitrificans |
| 369 | 3629953 | 3630195 | + | NC_015572.1 | Methylomonas methanica MC09 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP009610.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02878.18 | 0.77 | 284 | 3735 | opposite-strand | Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain I |
| 2 | PF02880.18 | 0.77 | 284 | 3735 | opposite-strand | Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain III |
| 3 | PF02879.18 | 0.77 | 284 | 3735 | opposite-strand | Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain II |
| 4 | PF00408.22 | 0.74 | 271 | 3733.5 | opposite-strand | Phosphoglucomutase/phosphomannomutase, C-terminal domain |
| 5 | PF00809.24 | 0.86 | 316 | 2889 | opposite-strand | Pterin binding enzyme |
| 6 | PF01434.20 | 0.9 | 331 | 845.0 | opposite-strand | Peptidase family M41 |
| 7 | PF00004.31 | 0.9 | 331 | 845.0 | opposite-strand | ATPase family associated with various cellular activities (AAA) |
| 8 | PF17862.3 | 0.9 | 330 | 845 | opposite-strand | AAA+ lid domain |
| 9 | PF06480.17 | 0.84 | 308 | 845 | opposite-strand | FtsH Extracellular |
| 10 | PF07728.16 | 0.88 | 325 | 845 | opposite-strand | AAA domain (dynein-related subfamily) |
| 11 | PF01728.21 | 0.89 | 326 | 127 | opposite-strand | FtsJ-like methyltransferase |
| 12 | PF03449.17 | 0.75 | 275 | 135.0 | opposite-strand | Transcription elongation factor, N-terminal |
| 13 | PF01272.21 | 0.75 | 275 | 135.0 | opposite-strand | Transcription elongation factor, GreA/GreB, C-term |
++ More..