| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Putative antitoxin RelB |
| NCBI Accession ID | L42023.1 |
| Organism | Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) |
| Left | 757421 |
| Right | 757717 |
| Strand | + |
| Nucleotide Sequence | ATGGCACTTACTAATTCCTCTATCAGTTTTAGAACAGTTGAGAAAACAAAATTAGAAGCTTATCAAGTTATTGAACAATATGGACTTACCCCATCACAAGTATTCAATATGTTTTTGGCTCAAATTGCCAAGACTCGCTCTATCCCTGTTGATTTGAATTATCTTCGCCCAAATAAAGAAACCCTAGCAGCTATTGATGAATTAGATAGTGGTAACGCAGAGAGCTTCTTTATTGAAGCTAGTGAAAATTATTCTGCCGAAGAATTTACAAAACGCATTCTTAATGGTGGTCAATAA |
| Sequence | MALTNSSISFRTVEKTKLEAYQVIEQYGLTPSQVFNMFLAQIAKTRSIPVDLNYLRPNKETLAAIDELDSGNAESFFIEASENYSAEEFTKRILNGGQ |
| Source of smORF | Swiss-Prot |
| Function | Antitoxin component of a type II toxin-antitoxin (TA) system. Its cognate toxin is YafQ (By similarity). {ECO:0000250}. |
| Pubmed ID | 7542800 15718296 |
| Domain | CDD:412776 |
| Functional Category | Antitoxin_type_2 |
| Uniprot ID | P71357 |
| ORF Length (Amino Acid) | 98 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 322591 | 322887 | - | NZ_CP009610.1 | Haemophilus influenzae |
| 2 | 826529 | 826819 | + | NZ_CP018804.1 | Histophilus somni |
| 3 | 473002 | 473286 | + | NZ_CP016180.1 | Pasteurella skyensis |
| 4 | 1130645 | 1130932 | - | NZ_CP047165.1 | Pelistega ratti |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF15738.7 | 1.0 | 4 | 2.0 | same-strand | Bacterial toxin of type II toxin-antitoxin system, YafQ |
| 2 | PF05016.17 | 1.0 | 4 | 2.0 | same-strand | ParE toxin of type II toxin-antitoxin system, parDE |