Result : P71071
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | ESX secretion system protein YukD |
| NCBI Accession ID | Z82015.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 4117 |
| Right | 4356 |
| Strand | - |
| Nucleotide Sequence | ATGTATATTGATATTACAATAGATTTGAAACATTATAACGGCAGTGTCTTTGATCTCAGATTGTCAGATTACCACCCGGTGAAAAAAGTAATTGATATTGCTTGGCAGGCCCAAAGCGTATCTATGCCTCCGCGCGAAGGGCACTGGATCAGAGTGGTGAACAAGGATAAGGTGTTTTCCGGAGAATGCAAGCTGTCTGATTGCGGCATTACAAACGGAGACCGGCTTGAAATATTATGA |
| Sequence | MYIDITIDLKHYNGSVFDLRLSDYHPVKKVIDIAWQAQSVSMPPREGHWIRVVNKDKVFSGECKLSDCGITNGDRLEIL |
| Source of smORF | Swiss-Prot |
| Function | Required for YukE secretion. Probable component or regulator of the ESX/ESAT-6-like secretion system (BsEss). {ECO:0000269|Pubmed:23861817, ECO:0000269|Pubmed:24798022}. |
| Pubmed ID | 9168598 9384377 15576783 23861817 24798022 15978580 |
| Domain | CDD:214563 |
| Functional Category | Others |
| Uniprot ID | P71071 |
| ORF Length (Amino Acid) | 79 |
++ More..
| Conservation Analysis |
No. of Species: 29
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3275832 | 3276071 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 3139432 | 3139671 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 3 | 3076697 | 3076936 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 4 | 3139776 | 3140015 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 5 | 3071132 | 3071371 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 6 | 3062341 | 3062580 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 7 | 2986915 | 2987154 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 8 | 3071242 | 3071481 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 9 | 914477 | 914716 | + | NZ_CP011937.1 | Bacillus velezensis |
| 10 | 3231840 | 3232079 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 11 | 3457061 | 3457300 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
| 12 | 3635336 | 3635575 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
| 13 | 2412331 | 2412570 | + | NZ_CP043404.1 | Bacillus safensis |
| 14 | 2507285 | 2507524 | + | NZ_CP017786.1 | Bacillus xiamenensis |
| 15 | 2897432 | 2897671 | - | NZ_CP011150.1 | Bacillus altitudinis |
| 16 | 3937340 | 3937579 | - | NZ_CP014616.1 | Sporosarcina psychrophila |
| 17 | 1493173 | 1493412 | - | NZ_CP022983.1 | Cytobacillus kochii |
| 18 | 369311 | 369550 | + | NZ_CP015378.1 | Fictibacillus phosphorivorans |
| 19 | 4324692 | 4324931 | + | NZ_CP016020.1 | Bacillus weihaiensis |
| 20 | 2692922 | 2693161 | - | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 21 | 333452 | 333691 | + | NZ_CP024035.1 | Priestia aryabhattai |
| 22 | 303081 | 303296 | + | NC_013791.2 | Alkalihalobacillus pseudofirmus OF4 |
| 23 | 699151 | 699390 | + | NZ_CP017962.1 | Virgibacillus halodenitrificans |
| 24 | 911321 | 911560 | + | NZ_CP070511.1 | Parageobacillus toebii |
| 25 | 128927 | 129166 | - | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 26 | 895493 | 895732 | + | NZ_CP053989.1 | Niallia circulans |
| 27 | 2970069 | 2970308 | - | NZ_CP022437.1 | Virgibacillus necropolis |
| 28 | 2827280 | 2827528 | + | NZ_CP030926.1 | Peribacillus butanolivorans |
| 29 | 2217505 | 2217753 | - | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF17355.4 | 1.0 | 29 | 8868 | same-strand | Family of unknown function (DUF5383) |
| 2 | PF01580.20 | 0.97 | 28 | 1382.0 | same-strand | FtsK/SpoIIIE family |
| 3 | PF12538.10 | 1.0 | 29 | 1384 | same-strand | DNA transporter |
| 4 | PF13401.8 | 0.97 | 28 | 1394.0 | same-strand | AAA domain |
| 5 | PF10140.11 | 1.0 | 29 | 15 | same-strand | WXG100 protein secretion system (Wss), protein YukC |
| 6 | PF06013.14 | 1.0 | 29 | 80.5 | same-strand | Proteins of 100 residues with WXG |
| 7 | PF10824.10 | 0.97 | 28 | 80.0 | same-strand | Excreted virulence factor EspC, type VII ESX diderm |
++ More..