Protein Information |
Information Type | Description |
---|---|
Protein name | ESX secretion system protein YukD |
NCBI Accession ID | Z82015.1 |
Organism | Bacillus subtilis (strain 168) |
Left | 4117 |
Right | 4356 |
Strand | - |
Nucleotide Sequence | ATGTATATTGATATTACAATAGATTTGAAACATTATAACGGCAGTGTCTTTGATCTCAGATTGTCAGATTACCACCCGGTGAAAAAAGTAATTGATATTGCTTGGCAGGCCCAAAGCGTATCTATGCCTCCGCGCGAAGGGCACTGGATCAGAGTGGTGAACAAGGATAAGGTGTTTTCCGGAGAATGCAAGCTGTCTGATTGCGGCATTACAAACGGAGACCGGCTTGAAATATTATGA |
Sequence | MYIDITIDLKHYNGSVFDLRLSDYHPVKKVIDIAWQAQSVSMPPREGHWIRVVNKDKVFSGECKLSDCGITNGDRLEIL |
Source of smORF | Swiss-Prot |
Function | Required for YukE secretion. Probable component or regulator of the ESX/ESAT-6-like secretion system (BsEss). {ECO:0000269|Pubmed:23861817, ECO:0000269|Pubmed:24798022}. |
Pubmed ID | 9168598 9384377 15576783 23861817 24798022 15978580 |
Domain | CDD:214563 |
Functional Category | Others |
Uniprot ID | P71071 |
ORF Length (Amino Acid) | 79 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 3275832 | 3276071 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
2 | 3139432 | 3139671 | - | NZ_CP033052.1 | Bacillus vallismortis |
3 | 3076697 | 3076936 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
4 | 3139776 | 3140015 | - | NZ_CP013984.1 | Bacillus inaquosorum |
5 | 3071132 | 3071371 | - | NZ_CP048852.1 | Bacillus tequilensis |
6 | 3062341 | 3062580 | - | NZ_CP051464.1 | Bacillus mojavensis |
7 | 2986915 | 2987154 | + | NZ_CP029364.1 | Bacillus halotolerans |
8 | 3071242 | 3071481 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
9 | 914477 | 914716 | + | NZ_CP011937.1 | Bacillus velezensis |
10 | 3231840 | 3232079 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
11 | 3457061 | 3457300 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
12 | 3635336 | 3635575 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
13 | 2412331 | 2412570 | + | NZ_CP043404.1 | Bacillus safensis |
14 | 2507285 | 2507524 | + | NZ_CP017786.1 | Bacillus xiamenensis |
15 | 2897432 | 2897671 | - | NZ_CP011150.1 | Bacillus altitudinis |
16 | 3937340 | 3937579 | - | NZ_CP014616.1 | Sporosarcina psychrophila |
17 | 1493173 | 1493412 | - | NZ_CP022983.1 | Cytobacillus kochii |
18 | 369311 | 369550 | + | NZ_CP015378.1 | Fictibacillus phosphorivorans |
19 | 4324692 | 4324931 | + | NZ_CP016020.1 | Bacillus weihaiensis |
20 | 2692922 | 2693161 | - | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
21 | 333452 | 333691 | + | NZ_CP024035.1 | Priestia aryabhattai |
22 | 303081 | 303296 | + | NC_013791.2 | Alkalihalobacillus pseudofirmus OF4 |
23 | 699151 | 699390 | + | NZ_CP017962.1 | Virgibacillus halodenitrificans |
24 | 911321 | 911560 | + | NZ_CP070511.1 | Parageobacillus toebii |
25 | 128927 | 129166 | - | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
26 | 895493 | 895732 | + | NZ_CP053989.1 | Niallia circulans |
27 | 2970069 | 2970308 | - | NZ_CP022437.1 | Virgibacillus necropolis |
28 | 2827280 | 2827528 | + | NZ_CP030926.1 | Peribacillus butanolivorans |
29 | 2217505 | 2217753 | - | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF17355.4 | 1.0 | 29 | 8868 | same-strand | Family of unknown function (DUF5383) |
2 | PF01580.20 | 0.97 | 28 | 1382.0 | same-strand | FtsK/SpoIIIE family |
3 | PF12538.10 | 1.0 | 29 | 1384 | same-strand | DNA transporter |
4 | PF13401.8 | 0.97 | 28 | 1394.0 | same-strand | AAA domain |
5 | PF10140.11 | 1.0 | 29 | 15 | same-strand | WXG100 protein secretion system (Wss), protein YukC |
6 | PF06013.14 | 1.0 | 29 | 80.5 | same-strand | Proteins of 100 residues with WXG |
7 | PF10824.10 | 0.97 | 28 | 80.0 | same-strand | Excreted virulence factor EspC, type VII ESX diderm |