Result : P71066

Protein Information

• Protein name: Uncharacterized protein YvfG
• NCBI Accession ID: Z71928.1
• Organism: Bacillus subtilis (strain 168)
• Left: 18128
• Right: 18346
• Strand: -
• Nucleotide Sequence: ATGTCTGAACTTTTTTCCGTCCCTTATTTTATTGAGAATTTAAAACAGCATATTGAAATGAATCAGTCTGAGGATAAAATCCACGCGATGAACAGCTACTACCGTTCCGTCGTCTCAACACTAGTGCAGGACCAGCTGACGAAAAACGCAGTTGTCCTGAAACGGATTCAGCATTTAGATGAAGCATACAACAAAGTCAAACGTGGAGAATCAAAATAA
• Sequence: MSELFSVPYFIENLKQHIEMNQSEDKIHAMNSYYRSVVSTLVQDQLTKNAVVLKRIQHLDEAYNKVKRGESK
• Source of smORF: Swiss-Prot
• Function: The ORF matches to the profile of pfam09628. Profile Description: YvfG protein. Yvfg is a hypothetical protein of 71 residues expressed in some bacteria. The monomer consists of two parallel alpha helices, and the protein crystallizes as a homo-dimer.
• Pubmed ID: 8969506 9384377
• Domain: CDD:401531
• Functional Category: Others
• Uniprot ID: P71066
• ORF Length (Amino Acid): 72

Conservation Analysis

No. of Species: 17

Sr.No.	Left Position	Right Position	Strand	NCBI Accession id	Species Name
1	3331255	3331473	+	NZ_CP034943.1	Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499
2	3513887	3514105	+	NC_000964.3	Bacillus subtilis subsp. subtilis str. 168
3	3380330	3380548	+	NZ_CP033052.1	Bacillus vallismortis
4	3335362	3335580	+	NZ_CP048852.1	Bacillus tequilensis
5	3380567	3380785	+	NZ_CP013984.1	Bacillus inaquosorum
6	3307819	3308037	+	NZ_CP051464.1	Bacillus mojavensis
7	2727283	2727501	-	NZ_CP029364.1	Bacillus halotolerans
8	655686	655904	-	NZ_CP011937.1	Bacillus velezensis
9	3396772	3396990	+	NZ_CP053376.1	Bacillus amyloliquefaciens
10	3923182	3923394	+	NZ_LT603683.1	Bacillus glycinifermentans
11	3700502	3700717	+	NZ_CP023665.1	Bacillus paralicheniformis
12	3506822	3507037	+	NC_006270.3	Bacillus licheniformis DSM 13 = ATCC 14580
13	3083450	3083665	+	NZ_CP011150.1	Bacillus altitudinis
14	2223296	2223511	-	NZ_CP043404.1	Bacillus safensis
15	2271642	2271857	-	NZ_CP017786.1	Bacillus xiamenensis
16	1817821	1818036	-	NZ_CP017703.1	Aeribacillus pallidus
17	3354681	3354896	+	NZ_CP015378.1	Fictibacillus phosphorivorans

Neighborhood Conservation Analysis

^* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
^* 'Small ORF' represents the entry/query analyzed.
^* Image generated using 'gggenes'(R-Package).

Neighborhood Representative Chosen(Species): NZ_CP034943.1

Sr.No.	Domain	Co-occurrence Frequency	No. of species in which domain occurs with smORF	Median distance b/w smORF and domain bearing ORFs	Orientation relative to smORF	PFAM Information
1	PF07729.14	0.88	15	3317	opposite-strand	FCD domain
2	PF00392.23	0.88	15	3317	opposite-strand	Bacterial regulatory proteins, gntR family
3	PF14502.8	0.88	15	3317	opposite-strand	Helix-turn-helix domain
4	PF02652.16	0.71	12	1417.5	same-strand	L-lactate permease
5	PF04552.15	1.0	17	78	opposite-strand	Sigma-54, DNA binding domain
6	PF04963.15	1.0	17	78	opposite-strand	Sigma-54 factor, core binding domain
7	PF00309.22	1.0	17	78	opposite-strand	Sigma-54 factor, Activator interacting domain (AID)
8	PF04230.15	0.76	13	11	opposite-strand	Polysaccharide pyruvyl transferase
9	PF01041.19	0.76	13	957	opposite-strand	DegT/DnrJ/EryC1/StrS aminotransferase family
10	PF17836.3	0.76	13	2140	opposite-strand	PglD N-terminal domain
11	PF00132.26	0.65	11	2140	opposite-strand	Bacterial transferase hexapeptide (six repeats)
12	PF02397.18	0.76	13	2775	opposite-strand	Bacterial sugar transferase
13	PF01943.19	0.76	13	3380	opposite-strand	Polysaccharide biosynthesis protein
14	PF14667.8	0.71	12	3380.5	opposite-strand	Polysaccharide biosynthesis C-terminal domain