Result : P71032
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Small, acid-soluble spore protein P (SASP P) |
| NCBI Accession ID | U72073.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 431 |
| Right | 577 |
| Strand | + |
| Nucleotide Sequence | ATGACCAATAAGAATACAAGTAAAGATATGCATAAAAACGCCCCTAAAGGACACAATCCCGGCCAACCCGAGCCTCTAAGCGGAAGCAAAAAAGTAAAAAACCGAAACCATACAAGACAAAAGCACAACTCAAGCCATGATATGTAA |
| Sequence | MTNKNTSKDMHKNAPKGHNPGQPEPLSGSKKVKNRNHTRQKHNSSHDM |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl23918. Profile Description: Small acid-soluble spore protein P family. This family consists of the small acid-soluble spore proteins (SASP) P type (sspP). sspP is expressed only in the forespore compartment of the sporulating cell. sspP is also expressed under sigma-G control from the same promoter as sspO. Mutations deleting sspP causes no discernible effect on sporulation, spore properties or spore germination. |
| Pubmed ID | 9068633 9384377 10806362 |
| Domain | CDD:420091 |
| Functional Category | Others |
| Uniprot ID | P71032 |
| ORF Length (Amino Acid) | 48 |
++ More..
| Conservation Analysis |
No. of Species: 45
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2039105 | 2039251 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 2 | 1926128 | 1926274 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 3 | 44113 | 44259 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 4 | 1834444 | 1834590 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 5 | 1890016 | 1890162 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 6 | 1853339 | 1853485 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 7 | 1875198 | 1875344 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 8 | 1888211 | 1888357 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 9 | 2080490 | 2080636 | + | NZ_CP011937.1 | Bacillus velezensis |
| 10 | 795550 | 795696 | - | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 11 | 2624251 | 2624397 | + | NZ_CP070511.1 | Parageobacillus toebii |
| 12 | 2177921 | 2178040 | - | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 13 | 1309046 | 1309165 | - | NZ_CP012152.1 | Anoxybacillus gonensis |
| 14 | 822130 | 822276 | - | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 15 | 456778 | 456924 | - | NZ_CP061470.1 | Geobacillus zalihae |
| 16 | 1366592 | 1366738 | - | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 17 | 2002132 | 2002278 | + | NZ_CP014342.1 | Geobacillus subterraneus |
| 18 | 2036053 | 2036199 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
| 19 | 1985467 | 1985613 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 20 | 1972094 | 1972240 | - | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 21 | 2284099 | 2284218 | - | NZ_CP042593.1 | Bacillus dafuensis |
| 22 | 2173150 | 2173296 | + | NZ_CP016020.1 | Bacillus weihaiensis |
| 23 | 4627734 | 4627853 | + | NZ_CP041305.1 | Cytobacillus ciccensis |
| 24 | 2616315 | 2616461 | + | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 25 | 3540025 | 3540171 | + | NZ_CP043404.1 | Bacillus safensis |
| 26 | 1775618 | 1775764 | - | NZ_CP011150.1 | Bacillus altitudinis |
| 27 | 3550042 | 3550188 | + | NZ_CP017786.1 | Bacillus xiamenensis |
| 28 | 2609091 | 2609234 | - | NZ_CP053989.1 | Niallia circulans |
| 29 | 158473 | 158616 | + | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 30 | 1576102 | 1576242 | - | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 31 | 4994629 | 4994772 | - | NZ_CP030926.1 | Peribacillus butanolivorans |
| 32 | 2168646 | 2168795 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
| 33 | 2437197 | 2437316 | + | NZ_CP018866.1 | Sutcliffiella cohnii |
| 34 | 369476 | 369622 | - | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 35 | 1694603 | 1694722 | + | NZ_CP012024.1 | Bacillus smithii |
| 36 | 2529712 | 2529852 | + | NZ_CP024035.1 | Priestia aryabhattai |
| 37 | 2421969 | 2422106 | + | NC_002570.2 | Alkalihalobacillus halodurans C-125 |
| 38 | 3735215 | 3735352 | - | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
| 39 | 2188961 | 2189098 | + | NC_013791.2 | Alkalihalobacillus pseudofirmus OF4 |
| 40 | 2360982 | 2361125 | + | NZ_CP024109.1 | Bacillus cytotoxicus |
| 41 | 1806172 | 1806312 | - | NZ_CP015378.1 | Fictibacillus phosphorivorans |
| 42 | 1034961 | 1035095 | + | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 43 | 2072280 | 2072408 | + | NZ_CP065425.1 | Heyndrickxia vini |
| 44 | 1878716 | 1878862 | - | NZ_CP023704.1 | Caldibacillus thermoamylovorans |
| 45 | 2325800 | 2325940 | - | NC_014829.1 | Evansella cellulosilytica DSM 2522 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP033052.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF08175.14 | 0.87 | 39 | 457 | same-strand | Small acid-soluble spore protein O family |
| 2 | PF00330.22 | 0.98 | 44 | 827.5 | opposite-strand | Aconitase family (aconitate hydratase) |
| 3 | PF00694.21 | 0.98 | 44 | 827.5 | opposite-strand | Aconitase C-terminal domain |
++ More..