Result : P71010
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Antilisterial bacteriocin subtilosin biosynthesis protein AlbB |
| NCBI Accession ID | AJ430547.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 2002 |
| Right | 2163 |
| Strand | + |
| Nucleotide Sequence | TTGTCACCAGCACAAAGAAGAATTTTACTGTATATCCTTTCATTTATCTTTGTCATCGGCGCAGTCGTCTATTTTGTCAAAAGCGATTATCTATTTACGCTGATTTTCATAGCCATTGCCATTCTTTTCGGGATGCGCGCGCGGAAGGCTGACTCGCGATGA |
| Sequence | MSPAQRRILLYILSFIFVIGAVVYFVKSDYLFTLIFIAIAILFGMRARKADSR |
| Source of smORF | Swiss-Prot |
| Function | Involved in the production of the bacteriocin subtilosin. Required for maximal production and for optimal immunity to subtilosin. {ECO:0000269|Pubmed:10572140, ECO:0000269|Pubmed:10809709}. |
| Pubmed ID | 9353933 9384377 10572140 10809709 10809710 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | P71010 |
| ORF Length (Amino Acid) | 53 |
++ More..
| Conservation Analysis |
No. of Species: 7
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3837682 | 3837843 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 3727334 | 3727495 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 3 | 3665264 | 3665425 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 4 | 3668755 | 3668916 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 5 | 2400781 | 2400942 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 6 | 3710204 | 3710365 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 7 | 3652347 | 3652508 | + | NZ_CP051464.1 | Bacillus mojavensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF07690.18 | 1.0 | 7 | 4137 | opposite-strand | Major Facilitator Superfamily |
| 2 | PF05746.17 | 1.0 | 7 | 2362 | opposite-strand | DALR anticodon binding domain |
| 3 | PF00750.21 | 1.0 | 7 | 2362 | opposite-strand | tRNA synthetases class I (R) |
| 4 | PF03485.18 | 1.0 | 7 | 2362 | opposite-strand | Arginyl tRNA synthetase N terminal domain |
| 5 | PF09148.12 | 1.0 | 7 | 1937 | opposite-strand | Domain of unknown function (DUF1934) |
| 6 | PF11420.10 | 0.86 | 6 | 1494.0 | same-strand | Bacteriocin subtilosin A |
| 7 | PF04055.23 | 1.0 | 7 | 13 | same-strand | Radical SAM superfamily |
| 8 | PF13186.8 | 1.0 | 7 | 13 | same-strand | Iron-sulfur cluster-binding domain |
| 9 | PF05402.14 | 1.0 | 7 | 13 | same-strand | Coenzyme PQQ synthesis protein D (PqqD) |
| 10 | PF00005.29 | 0.86 | 6 | -3.0 | same-strand | ABC transporter |
++ More..