Result : P71001
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Phosphatase RapF inhibitor (Phosphatase regulator F) |
| NCBI Accession ID | Z80360.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 8812 |
| Right | 8931 |
| Strand | - |
| Nucleotide Sequence | ATGAAATTGAAGTCTAAACTATTACTCTCTTGTCTGGCTCTAAGCACTGTGTTCGTGGCAACAACTATTGCAAATGCACCTACACACCAAATTGAAGTTGCACAACGAGGAATGATTTAA |
| Sequence | MKLKSKLLLSCLALSTVFVATTIANAPTHQIEVAQRGMI |
| Source of smORF | Swiss-Prot |
| Function | Inhibitor of the activity of phosphatase RapF. |
| Pubmed ID | 9353933 9384377 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | P71001 |
| ORF Length (Amino Acid) | 39 |
++ More..
| Conservation Analysis |
No. of Species: 5
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3847130 | 3847249 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 382865 | 382987 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 3 | 585986 | 586108 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 4 | 2392227 | 2392346 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 5 | 3661775 | 3661894 | + | NZ_CP051464.1 | Bacillus mojavensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF18801.3 | 1.0 | 5 | -16 | same-strand | response regulator aspartate phosphatase H, N terminal |
| 2 | PF13424.8 | 1.0 | 5 | -16 | same-strand | Tetratricopeptide repeat |
| 3 | PF00491.23 | 0.6 | 3 | 131 | opposite-strand | Arginase family |
| 4 | PF01564.19 | 0.6 | 3 | 1065 | opposite-strand | Spermine/spermidine synthase domain |
| 5 | PF17284.4 | 0.6 | 3 | 1065 | opposite-strand | Spermidine synthase tetramerisation domain |
| 6 | PF00912.24 | 0.6 | 3 | 2097 | same-strand | Transglycosylase |
| 7 | PF00905.24 | 0.6 | 3 | 2097 | same-strand | Penicillin binding protein transpeptidase domain |
| 8 | PF08741.12 | 0.6 | 3 | 4780 | opposite-strand | YwhD family |
++ More..