Result : P70994
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 2-hydroxymuconate tautomerase (EC 5.3.2.6) ((2Z,4E)-2-hydroxyhexa-2,4-dienedioate keto-enol isomerase) (4-oxalocrotonate tautomerase) (4-OT) |
| NCBI Accession ID | Z80360.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 2388 |
| Right | 2576 |
| Strand | - |
| Nucleotide Sequence | ATGCCATACGTAACTGTCAAAATGCTCGAAGGCCGTACAGACGAGCAAAAACGCAATCTTGTCGAGAAAGTAACAGAAGCCGTAAAGGAAACAACCGGTGCTTCTGAAGAAAAAATTGTTGTCTTTATAGAAGAAATGAGAAAAGACCATTATGCCGTCGCAGGCAAACGCCTGAGCGATATGGAATAA |
| Sequence | MPYVTVKMLEGRTDEQKRNLVEKVTEAVKETTGASEEKIVVFIEEMRKDHYAVAGKRLSDME |
| Source of smORF | Swiss-Prot |
| Function | Catalyzes both 1,3- and 1,5-keto-enol tautomerization of the diacid 2-hydroxymuconate (2-hydroxy-2,4-hexadienedioate) to produce 2-oxo-4-hexenedioate. This reaction is highly stereoselective and produces a mixture of stereoisomers, where the (3S)-isomer of 2-oxo-4-hexenedioate predominates. Also catalyzes the tautomerization of 2-hydroxymuconate to 2-oxo-3-hexenedioate, however this reaction is slower and occurs after the tautomerization of 2-hydroxymuconate to 2-oxo-4-hexenedioate. Using 2-hydroxy-2,4-pentadienoate, phenylenolpyruvate, (p-hydroxyphenyl)-enolpyruvate and 2-hydroxy-2,4-heptadiene-1,7-dioate, YwhB is a highly efficient 1,3-keto-enol tautomerase, but clearly not a 1,5-keto-enol tautomerase. Tautomerization of the two monoacids 2-hydroxy-2,4-pentadienoate and phenylenolpyruvate produces a mixture of stereoisomers, where the (3R)-isomers predominate. {ECO:0000269|Pubmed:17902707}. |
| Pubmed ID | 9353933 9384377 17902707 |
| Domain | CDD:412246 |
| Functional Category | Others |
| Uniprot ID | P70994 |
| ORF Length (Amino Acid) | 62 |
++ More..
| Conservation Analysis |
No. of Species: 127
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3723751 | 3723939 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 2 | 3686913 | 3687101 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 3 | 3679360 | 3679548 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 4 | 3743147 | 3743335 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 5 | 2385986 | 2386174 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 6 | 3853486 | 3853674 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 7 | 3667974 | 3668162 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 8 | 341874 | 342062 | - | NZ_CP011937.1 | Bacillus velezensis |
| 9 | 3708688 | 3708876 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 10 | 708117 | 708302 | - | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 11 | 307188 | 307373 | - | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 12 | 3025502 | 3025687 | + | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 13 | 3251164 | 3251352 | + | NZ_CP012024.1 | Bacillus smithii |
| 14 | 2690176 | 2690364 | + | NZ_CP012152.1 | Anoxybacillus gonensis |
| 15 | 4971200 | 4971385 | + | NZ_CP053989.1 | Niallia circulans |
| 16 | 554795 | 554980 | - | NZ_CP070511.1 | Parageobacillus toebii |
| 17 | 4449132 | 4449320 | + | NZ_CP018866.1 | Sutcliffiella cohnii |
| 18 | 4533937 | 4534125 | + | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 19 | 3324958 | 3325146 | - | NZ_CP014342.1 | Geobacillus subterraneus |
| 20 | 2612813 | 2613001 | + | NZ_CP061470.1 | Geobacillus zalihae |
| 21 | 366924 | 367112 | - | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 22 | 3451688 | 3451876 | + | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 23 | 4693974 | 4694159 | + | NZ_CP042593.1 | Bacillus dafuensis |
| 24 | 3807186 | 3807371 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 25 | 3955329 | 3955514 | + | NZ_LS483476.1 | Lederbergia lentus |
| 26 | 39342 | 39527 | - | NZ_CP040336.1 | Bacillus luti |
| 27 | 5113384 | 5113569 | + | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 28 | 5136481 | 5136666 | + | NZ_CP064875.1 | Bacillus toyonensis |
| 29 | 5301894 | 5302079 | + | NC_011725.1 | Bacillus cereus B4264 |
| 30 | 5338621 | 5338806 | + | NZ_CP032365.1 | Bacillus wiedmannii |
| 31 | 4012513 | 4012698 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 32 | 3950263 | 3950448 | + | NZ_CP024109.1 | Bacillus cytotoxicus |
| 33 | 2487986 | 2488174 | - | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 34 | 2130419 | 2130604 | - | NZ_CP041305.1 | Cytobacillus ciccensis |
| 35 | 3207605 | 3207787 | + | NZ_CP041666.1 | Radiobacillus deserti |
| 36 | 4065740 | 4065925 | + | NZ_CP065425.1 | Heyndrickxia vini |
| 37 | 4237258 | 4237443 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
| 38 | 2338356 | 2338541 | - | NZ_CP022983.1 | Cytobacillus kochii |
| 39 | 2453306 | 2453491 | + | NZ_CP038012.1 | Sporosarcina pasteurii |
| 40 | 3846402 | 3846587 | + | NZ_CP023704.1 | Caldibacillus thermoamylovorans |
| 41 | 4939280 | 4939465 | + | NZ_CP024035.1 | Priestia aryabhattai |
| 42 | 1906798 | 1906983 | - | NZ_CP043404.1 | Bacillus safensis |
| 43 | 3388024 | 3388209 | + | NZ_CP011150.1 | Bacillus altitudinis |
| 44 | 3276618 | 3276800 | + | NZ_CP029797.1 | Paraliobacillus zengyii |
| 45 | 2843866 | 2844051 | + | NZ_CP038015.1 | Paenisporosarcina antarctica |
| 46 | 3287518 | 3287712 | + | NZ_CP017560.1 | Sporosarcina ureilytica |
| 47 | 1965930 | 1966115 | - | NZ_CP017786.1 | Bacillus xiamenensis |
| 48 | 2041519 | 2041704 | + | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 49 | 2725562 | 2725747 | - | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 50 | 660038 | 660223 | - | NZ_CP031223.1 | Psychrobacillus glaciei |
| 51 | 2659772 | 2659957 | + | NZ_CP016538.2 | Planococcus maritimus |
| 52 | 2680295 | 2680480 | + | NZ_CP059540.1 | Planococcus maritimus |
| 53 | 2296126 | 2296311 | + | NZ_CP030926.1 | Peribacillus butanolivorans |
| 54 | 4218009 | 4218194 | + | NZ_CP014616.1 | Sporosarcina psychrophila |
| 55 | 3010880 | 3011065 | - | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 56 | 3936872 | 3937057 | + | NC_002570.2 | Alkalihalobacillus halodurans C-125 |
| 57 | 4310218 | 4310403 | + | NZ_CP010820.1 | Lysinibacillus fusiformis |
| 58 | 2589832 | 2590017 | + | NZ_CP016539.2 | Planococcus plakortidis |
| 59 | 4455979 | 4456164 | + | NC_014829.1 | Evansella cellulosilytica DSM 2522 |
| 60 | 2071298 | 2071486 | - | NC_018704.1 | Amphibacillus xylanus NBRC 15112 |
| 61 | 2473283 | 2473468 | + | NZ_CP013659.2 | Planococcus rifietoensis |
| 62 | 2919640 | 2919825 | + | NZ_CP009416.1 | Jeotgalibacillus malaysiensis |
| 63 | 515133 | 515318 | - | NZ_CP006837.1 | Lysinibacillus varians |
| 64 | 4154897 | 4155082 | + | NZ_CP019980.1 | Lysinibacillus sphaericus |
| 65 | 3707469 | 3707654 | + | NC_013791.2 | Alkalihalobacillus pseudofirmus OF4 |
| 66 | 2695461 | 2695646 | + | NZ_CP016543.2 | Planococcus donghaensis |
| 67 | 2413888 | 2414073 | - | NZ_CP015108.1 | Sporosarcina ureae |
| 68 | 2792102 | 2792287 | + | NZ_CP016537.2 | Planococcus halocryophilus |
| 69 | 2414180 | 2414365 | - | NZ_CP013661.2 | Planococcus kocurii |
| 70 | 2845791 | 2845976 | + | NZ_CP019401.1 | Planococcus faecalis |
| 71 | 2700118 | 2700303 | + | NZ_CP016540.2 | Planococcus versutus |
| 72 | 3015977 | 3016162 | + | NZ_CP016534.2 | Planococcus antarcticus DSM 14505 |
| 73 | 1030765 | 1030953 | - | NZ_CP013911.1 | Staphylococcus haemolyticus |
| 74 | 270607 | 270795 | - | NZ_CP040676.1 | Exiguobacterium mexicanum |
| 75 | 1523296 | 1523481 | + | NZ_CP035288.1 | Staphylococcus epidermidis |
| 76 | 1850409 | 1850594 | - | NZ_CP066042.1 | Staphylococcus saccharolyticus |
| 77 | 1586812 | 1586997 | + | NZ_AP018587.1 | Staphylococcus caprae |
| 78 | 1323566 | 1323751 | + | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
| 79 | 120644 | 120835 | - | NZ_CP012502.1 | Bacillus beveridgei |
| 80 | 1305926 | 1306111 | - | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 81 | 680741 | 680926 | - | NZ_CP007601.1 | Staphylococcus capitis subsp. capitis |
| 82 | 1458443 | 1458628 | + | NZ_LR134089.1 | Staphylococcus saprophyticus |
| 83 | 3324151 | 3324330 | - | NZ_CP008876.1 | Terribacillus goriensis |
| 84 | 1343014 | 1343199 | - | NZ_LT906460.1 | Staphylococcus simiae |
| 85 | 1469757 | 1469942 | + | NZ_LR134242.1 | Staphylococcus warneri |
| 86 | 2517495 | 2517680 | - | NC_022737.1 | Staphylococcus pasteuri SP1 |
| 87 | 1547756 | 1547941 | + | NZ_CP008724.1 | Staphylococcus xylosus |
| 88 | 1244514 | 1244699 | - | NZ_CP013114.1 | Staphylococcus equorum |
| 89 | 1160440 | 1160625 | - | NC_014925.1 | Staphylococcus pseudintermedius HKU10-03 |
| 90 | 564745 | 564933 | + | NZ_CP065729.1 | Macrococcus caseolyticus |
| 91 | 2176685 | 2176870 | + | NZ_CP033732.1 | Staphylococcus hominis |
| 92 | 323023 | 323208 | - | NZ_CP022096.2 | Staphylococcus pettenkoferi |
| 93 | 261979 | 262164 | - | NC_010556.1 | Exiguobacterium sibiricum 255-15 |
| 94 | 1149740 | 1149928 | + | NZ_CP039712.1 | Vagococcus zengguangii |
| 95 | 416198 | 416383 | + | NZ_CP014022.1 | Staphylococcus lugdunensis |
| 96 | 487656 | 487841 | - | NZ_CP011102.1 | Listeria weihenstephanensis |
| 97 | 1148039 | 1148227 | - | NZ_CP047361.1 | Macrococcus canis |
| 98 | 3478529 | 3478723 | - | NZ_CP054614.1 | Paenibacillus barcinonensis |
| 99 | 1406890 | 1407075 | - | NZ_LR134304.1 | Staphylococcus schweitzeri |
| 100 | 1267541 | 1267726 | + | NZ_LT906464.1 | Staphylococcus muscae |
| 101 | 766975 | 767160 | + | NZ_CP018199.1 | Staphylococcus succinus |
| 102 | 1322302 | 1322490 | + | NZ_CP065712.1 | Staphylococcus auricularis |
| 103 | 2379395 | 2379580 | - | NZ_CP020773.1 | Staphylococcus lutrae |
| 104 | 1491665 | 1491850 | + | NZ_CP064056.1 | Staphylococcus lloydii |
| 105 | 1369561 | 1369746 | + | NZ_LT906462.1 | Mammaliicoccus stepanovicii |
| 106 | 1291014 | 1291199 | + | NZ_CP022046.2 | Mammaliicoccus sciuri |
| 107 | 1018632 | 1018817 | - | NZ_CP045927.1 | Staphylococcus agnetis |
| 108 | 2818618 | 2818803 | - | NC_018515.1 | Desulfosporosinus meridiei DSM 13257 |
| 109 | 1265947 | 1266132 | - | NZ_CP054482.1 | Macrococcus bohemicus |
| 110 | 1538326 | 1538514 | + | NZ_CP008747.1 | Staphylococcus hyicus |
| 111 | 2542631 | 2542816 | + | NC_013891.1 | Listeria seeligeri serovar 1/2b str. SLCC3954 |
| 112 | 873281 | 873466 | - | NZ_CP068061.1 | Mammaliicoccus vitulinus |
| 113 | 2643753 | 2643938 | + | NC_003210.1 | Listeria monocytogenes EGD-e |
| 114 | 1047176 | 1047361 | - | NZ_CP045240.1 | Limosilactobacillus vaginalis |
| 115 | 2540244 | 2540429 | + | NZ_LR134483.1 | Listeria grayi |
| 116 | 1624129 | 1624314 | + | NZ_CP018776.1 | Staphylococcus condimenti |
| 117 | 1471955 | 1472140 | - | NZ_CP033460.1 | Staphylococcus debuckii |
| 118 | 1027767 | 1027952 | + | NZ_CP060720.1 | Vagococcus carniphilus |
| 119 | 1012526 | 1012714 | - | NZ_CP047141.1 | Ligilactobacillus animalis |
| 120 | 188651 | 188830 | - | NZ_CP049887.1 | Vagococcus hydrophili |
| 121 | 1342896 | 1343081 | - | NZ_CP023643.1 | Brochothrix thermosphacta |
| 122 | 1791094 | 1791279 | + | NC_014136.1 | Leuconostoc kimchii IMSNU 11154 |
| 123 | 877275 | 877451 | + | NZ_CP017267.1 | Vagococcus teuberi |
| 124 | 1092105 | 1092290 | - | NZ_CP028251.1 | Leuconostoc mesenteroides |
| 125 | 601122 | 601307 | + | NZ_CP015247.1 | Leuconostoc suionicum |
| 126 | 1954390 | 1954575 | + | NZ_CP042582.1 | Hypericibacter adhaerens |
| 127 | 2335140 | 2335331 | + | NZ_CP022196.1 | Celeribacter ethanolicus |
| 128 | 1244477 | 1244653 | + | NZ_AP022822.1 | Enterococcus saigonensis |
++ More..