Result : P70966
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YwmE |
| NCBI Accession ID | Z81356.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 6641 |
| Right | 6802 |
| Strand | + |
| Nucleotide Sequence | ATGAAATTATTCGGAATGATTTTTCTTATAGCCACCGTTGCATTTATATTGCTTGGTGTTCTTCTAAAACTGGCAGCCTTCTTTTTTGTCAGCATTCTCACCTTGATCGCAGCTATTGTGCTGTTTACGGTTCTGAAAAAGAATCAGCATAATCAAACATAG |
| Sequence | MKLFGMIFLIATVAFILLGVLLKLAAFFFVSILTLIAAIVLFTVLKKNQHNQT |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 9353933 9384377 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | P70966 |
| ORF Length (Amino Acid) | 53 |
++ More..
| Conservation Analysis |
No. of Species: 9
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3774400 | 3774561 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 3601520 | 3601681 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 3 | 3663607 | 3663768 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 4 | 3607115 | 3607276 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 5 | 3646716 | 3646877 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 6 | 2464565 | 2464726 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 7 | 3588771 | 3588932 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 8 | 412636 | 412773 | + | NZ_CP011937.1 | Bacillus velezensis |
| 9 | 3633423 | 3633560 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP034943.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF05532.14 | 1.0 | 9 | 3987 | same-strand | CsbD-like |
| 2 | PF18801.3 | 1.0 | 9 | 2132 | same-strand | response regulator aspartate phosphatase H, N terminal |
| 3 | PF06463.15 | 1.0 | 9 | 904 | same-strand | Molybdenum Cofactor Synthesis C |
| 4 | PF04055.23 | 1.0 | 9 | 904 | same-strand | Radical SAM superfamily |
| 5 | PF02634.17 | 1.0 | 9 | 101 | same-strand | FdhD/NarQ family |
| 6 | PF00092.30 | 1.0 | 9 | 601.0 | same-strand | von Willebrand factor type A domain |
| 7 | PF13519.8 | 1.0 | 9 | 601.0 | same-strand | von Willebrand factor type A domain |
| 8 | PF08486.12 | 1.0 | 9 | 2162 | same-strand | Stage II sporulation protein |
| 9 | PF00275.22 | 1.0 | 9 | 3389 | same-strand | EPSP synthase (3-phosphoshikimate 1-carboxyvinyltransferase) |
| 10 | PF08680.12 | 1.0 | 9 | 4733 | same-strand | TATA-box binding |
| 11 | PF13176.8 | 0.67 | 6 | 2132.0 | same-strand | Tetratricopeptide repeat |
++ More..