Result : P70964
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Stress response protein CsbD |
| NCBI Accession ID | Z81356.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 10910 |
| Right | 11098 |
| Strand | + |
| Nucleotide Sequence | ATGGGTAACGATAGTGTAAAAGACAAAATGAAGGGCGGCTTCAATAAAGCCAAAGGAGAAGTGAAGGATAAAGTCGGAGATATGGCTGACAGAACGGACATGCAGGCTGAAGGCAAAAAAGATAAGGCAAAAGGCGAAATCCAAAAGGATATCGGGAAAGCCAAGGATAAATTTTCAGATAAAGATTAA |
| Sequence | MGNDSVKDKMKGGFNKAKGEVKDKVGDMADRTDMQAEGKKDKAKGEIQKDIGKAKDKFSDKD |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl22912. Profile Description: CsbD-like. hypothetical protein; Provisional |
| Pubmed ID | 9384377 10376822 11988534 |
| Domain | CDD:419889 |
| Functional Category | Others |
| Uniprot ID | P70964 |
| ORF Length (Amino Acid) | 62 |
++ More..
| Conservation Analysis |
No. of Species: 42
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3770104 | 3770292 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 3584584 | 3584772 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 3 | 3659432 | 3659620 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 4 | 3642420 | 3642608 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 5 | 2468742 | 2468930 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 6 | 3597351 | 3597539 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 7 | 3602826 | 3603014 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 8 | 416696 | 416884 | + | NZ_CP011937.1 | Bacillus velezensis |
| 9 | 3629312 | 3629500 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 10 | 3132730 | 3132909 | - | NC_013791.2 | Alkalihalobacillus pseudofirmus OF4 |
| 11 | 31636 | 31824 | - | NZ_CP038015.1 | Paenisporosarcina antarctica |
| 12 | 6629297 | 6629470 | + | NZ_CP021780.1 | Paenibacillus donghaensis |
| 13 | 1679199 | 1679408 | + | NZ_CP015108.1 | Sporosarcina ureae |
| 14 | 720397 | 720597 | + | NZ_LS483476.1 | Lederbergia lentus |
| 15 | 4500526 | 4500720 | + | NZ_CP014616.1 | Sporosarcina psychrophila |
| 16 | 991848 | 992030 | - | NZ_CP024035.1 | Priestia aryabhattai |
| 17 | 6980826 | 6981005 | + | NZ_CP034235.1 | Paenibacillus psychroresistens |
| 18 | 2174676 | 2174852 | + | NZ_CP041217.1 | Saccharibacillus brassicae |
| 19 | 2230211 | 2230402 | + | NZ_CP059540.1 | Planococcus maritimus |
| 20 | 2207887 | 2208078 | + | NZ_CP016538.2 | Planococcus maritimus |
| 21 | 2187703 | 2187894 | + | NZ_CP016539.2 | Planococcus plakortidis |
| 22 | 116047 | 116232 | - | NZ_CP031223.1 | Psychrobacillus glaciei |
| 23 | 265410 | 265595 | + | NZ_CP013023.1 | Paenibacillus bovis |
| 24 | 2452259 | 2452444 | + | NZ_CP016537.2 | Planococcus halocryophilus |
| 25 | 2565469 | 2565633 | + | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 26 | 8753293 | 8753466 | + | NC_017672.3 | Paenibacillus mucilaginosus K02 |
| 27 | 2345270 | 2345455 | + | NZ_CP016543.2 | Planococcus donghaensis |
| 28 | 2361883 | 2362068 | + | NZ_CP016540.2 | Planococcus versutus |
| 29 | 3076907 | 3077089 | - | NZ_CP009416.1 | Jeotgalibacillus malaysiensis |
| 30 | 2759274 | 2759459 | - | NZ_CP013661.2 | Planococcus kocurii |
| 31 | 2503057 | 2503242 | + | NZ_CP019401.1 | Planococcus faecalis |
| 32 | 2648318 | 2648503 | + | NZ_CP016534.2 | Planococcus antarcticus DSM 14505 |
| 33 | 2204730 | 2204921 | + | NZ_CP008876.1 | Terribacillus goriensis |
| 34 | 1266254 | 1266406 | + | NZ_CP035485.1 | Salicibibacter halophilus |
| 35 | 465323 | 465484 | - | NZ_CP014205.2 | Pseudomonas glycinae |
| 36 | 5256878 | 5257069 | - | NZ_LS999205.1 | Pseudomonas protegens CHA0 |
| 37 | 4736036 | 4736197 | - | NZ_CP023272.1 | Pseudomonas lurida |
| 38 | 4805378 | 4805539 | - | NZ_CP010896.1 | Pseudomonas simiae |
| 39 | 3579600 | 3579761 | - | NZ_CP062158.2 | Pseudomonas lundensis |
| 40 | 2367150 | 2367341 | - | NZ_CP053989.1 | Niallia circulans |
| 41 | 2721991 | 2722176 | - | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 42 | 234834 | 235034 | + | NZ_CP029797.1 | Paraliobacillus zengyii |
| 43 | 2756123 | 2756287 | - | NC_004193.1 | Oceanobacillus iheyensis HTE831 |
++ More..