Result : P69968
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Protein TyeA |
| NCBI Accession ID | AF074612.1 |
| Organism | Yersinia pestis |
| Left | 33708 |
| Right | 33986 |
| Strand | + |
| Nucleotide Sequence | ATGGCGTACGACCTTTCTGAGTTTATGGGAGATATTGTCGCACTGGTTGACAAGCGCTGGGCGGGGATTCATGACATTGAACATCTTGCCAACGCCTTTTCCCTTCCTACGCCTGAAATCAAAGTGCGTTTCTATCAAGATTTAAAAAGAATGTTTCGTCTTTTCCCTCTGGGGGTATTTAGCGATGAGGAGCAACGGCAAAATTTATTGCAAATGTGTCAAAATGCGATCGATATGGCTATTGAGAGTGAAGAGGAAGAATTGAGTGAGTTGGATTGA |
| Sequence | MAYDLSEFMGDIVALVDKRWAGIHDIEHLANAFSLPTPEIKVRFYQDLKRMFRLFPLGVFSDEEQRQNLLQMCQNAIDMAIESEEEELSELD |
| Source of smORF | Swiss-Prot |
| Function | Involved in the control of Yop release. {ECO:0000250}. |
| Pubmed ID | 9746557 9748454 11586360 15368893 |
| Domain | CDD:420081 |
| Functional Category | Others |
| Uniprot ID | P69968 |
| ORF Length (Amino Acid) | 92 |
++ More..
| Conservation Analysis |
No. of Species: 5
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 585169 | 585456 | - | NZ_CP011104.1 | Photorhabdus thracensis |
| 2 | 4432827 | 4433114 | - | NC_005126.1 | Photorhabdus laumondii subsp. laumondii TTO1 |
| 3 | 3091732 | 3092013 | - | NZ_LR134376.1 | Aeromonas encheleia |
| 4 | 2160190 | 2160471 | - | NZ_CP065745.1 | Aeromonas allosaccharophila |
| 5 | 1201418 | 1201681 | + | NC_012962.1 | Photorhabdus asymbiotica |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP011104.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF09621.12 | 1.0 | 5 | 3178 | same-strand | Type III secretion system regulator (LcrR) |
| 2 | PF00771.22 | 1.0 | 5 | 1059 | same-strand | FHIPEP family |
| 3 | PF13428.8 | 0.8 | 4 | 733.0 | same-strand | Tetratricopeptide repeat |
| 4 | PF09474.12 | 1.0 | 5 | 365 | same-strand | Type III secretion system YscX (type III YscX) |
| 5 | PF07201.13 | 0.8 | 4 | -19.0 | same-strand | HrpJ-like domain |
| 6 | PF00006.27 | 1.0 | 5 | 1049 | opposite-strand | ATP synthase alpha/beta family, nucleotide-binding domain |
| 7 | PF18269.3 | 1.0 | 5 | 1049 | opposite-strand | T3SS EscN ATPase C-terminal domain |
| 8 | PF02874.25 | 1.0 | 5 | 1049 | opposite-strand | ATP synthase alpha/beta family, beta-barrel domain |
| 9 | PF07321.14 | 1.0 | 5 | 2368 | opposite-strand | Type III secretion protein YscO |
| 10 | PF01052.22 | 1.0 | 5 | 4205 | opposite-strand | Type III flagellar switch regulator (C-ring) FliN C-term |
++ More..