| Protein name |
Low calcium response locus protein G |
| NCBI Accession ID |
M57893.1 |
| Organism |
Yersinia pseudotuberculosis serotype I (strain IP32953) |
| Left |
264 |
| Right |
551 |
| Strand |
+ |
| Nucleotide Sequence |
ATGAAATCTTCCCATTTTGATGAATATGACAAAACGCTTAAACAGGCAGAACTGGCAATAGCCGACAGCGATCACCGCGCAAAATTATTGCAAGAAATGTGTGCTGATATCGGCTTAACGCCTGAAGCCGTAATGAAGATATTTGCGGGCCGTTCCGCCGAAGAGATAAAGCCAGCGGAGCGCGAGTTGCTTGATGAAATTAAGCGTCAGAGGGAGAGGCAGCCTCAACATCCCTACGATGGGAAGAGACCAAGAAAACCAACGATGATGCGAGGGCAAATTATTTAA |
| Sequence |
MKSSHFDEYDKTLKQAELAIADSDHRAKLLQEMCADIGLTPEAVMKIFAGRSAEEIKPAERELLDEIKRQRERQPQHPYDGKRPRKPTMMRGQII |
| Source of smORF |
Swiss-Prot |
| Function |
The ORF matches to the profile of cl23895. Profile Description: LcrG protein. This protein is found in type III secretion operons, along with LcrR, H and V. Also known as PcrG in Pseudomonas, the protein is believed to make a 1:1 complex with PcrV (LcrV). Mutants of LcrG cause premature secretion of effector proteins into the medium . |
| Pubmed ID |
1705541
15358858
|
| Domain |
CDD:305052 |
| Functional Category |
Others |
| Uniprot ID |
P69958
|
| ORF Length (Amino Acid) |
95 |