Result : P69889
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Degradation enzyme regulation protein DegQ (Regulatory factor SacQ) |
| NCBI Accession ID | AF459919.1 |
| Organism | Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) |
| Left | 1150 |
| Right | 1290 |
| Strand | + |
| Nucleotide Sequence | GTGGAAAAGCAACAAATTGAAGAATTAAAACAACTGCTTTGGCGGCTAGAGAATGAAATCAGAGAAACAAAGGACTCCTTGCGCAAGATTAACAAAAGCATTGATCAATACGATAAGTACACATATCTAAAAACCTCGTAA |
| Sequence | MEKQQIEELKQLLWRLENEIRETKDSLRKINKSIDQYDKYTYLKTS |
| Source of smORF | Swiss-Prot |
| Function | Stimulates the phosphotransfer from phospho-DegS to DegU. Affects protease and levansucrose production (By similarity). {ECO:0000250}. |
| Pubmed ID | 12007649 15383718 15461803 |
| Domain | CDD:285404 |
| Functional Category | Others |
| Uniprot ID | P69889 |
| ORF Length (Amino Acid) | 46 |
++ More..
| Conservation Analysis |
No. of Species: 17
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3435656 | 3435796 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
| 2 | 3210800 | 3210940 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 3 | 3613911 | 3614051 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
| 4 | 2877608 | 2877748 | - | NZ_CP011150.1 | Bacillus altitudinis |
| 5 | 2527410 | 2527550 | + | NZ_CP017786.1 | Bacillus xiamenensis |
| 6 | 2432409 | 2432549 | + | NZ_CP043404.1 | Bacillus safensis |
| 7 | 3053197 | 3053337 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 8 | 932620 | 932760 | + | NZ_CP011937.1 | Bacillus velezensis |
| 9 | 3005664 | 3005804 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 10 | 3043877 | 3044017 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 11 | 3051114 | 3051254 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 12 | 3057966 | 3058106 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 13 | 3121043 | 3121183 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 14 | 3257092 | 3257232 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 15 | 3120684 | 3120824 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 16 | 709876 | 710016 | + | NZ_CP016020.1 | Bacillus weihaiensis |
| 17 | 1906564 | 1906704 | + | NZ_CP017703.1 | Aeribacillus pallidus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP011150.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03061.24 | 0.82 | 14 | 4296.5 | same-strand | Thioesterase superfamily |
| 2 | PF00072.26 | 0.94 | 16 | 3629.0 | same-strand | Response regulator receiver domain |
| 3 | PF00196.21 | 0.94 | 16 | 3629.0 | same-strand | Bacterial regulatory proteins, luxR family |
| 4 | PF07730.15 | 0.94 | 16 | 1240.5 | same-strand | Histidine kinase |
| 5 | PF02518.28 | 0.94 | 16 | 1240.5 | same-strand | Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase |
| 6 | PF17767.3 | 0.88 | 15 | 2171 | same-strand | Nicotinate phosphoribosyltransferase (NAPRTase) N-terminal domain |
| 7 | PF17956.3 | 0.88 | 15 | 2171 | same-strand | Nicotinate phosphoribosyltransferase C-terminal domain |
| 8 | PF04095.18 | 0.88 | 15 | 2171 | same-strand | Nicotinate phosphoribosyltransferase (NAPRTase) family |
| 9 | PF00857.22 | 0.88 | 15 | 3659 | same-strand | Isochorismatase family |
| 10 | PF07997.13 | 0.65 | 11 | 4307 | same-strand | Protein of unknown function (DUF1694) |
| 11 | PF05952.14 | 0.65 | 11 | 1053 | same-strand | Bacillus competence pheromone ComX |
++ More..