Protein Information |
Information Type | Description |
---|---|
Protein name | Regulatory protein DegR |
NCBI Accession ID | M15318.1 |
Organism | Bacillus subtilis (strain 168) |
Left | 417 |
Right | 599 |
Strand | + |
Nucleotide Sequence | ATGGATGATAAAGACTTGAAGTTGATCCTTCACAAAACATTTATAGAAATATACAGTGATTTAGAAGAACTGGCCGATATCGCGAAAAAAGGAAAACCATCAATGGAAAAGTATGTTGAAGAGATTGAACAGAGGTGTAAACAAAACATTTTGGCGATTGAAATCCAGATGAAAATCAAATAG |
Sequence | MDDKDLKLILHKTFIEIYSDLEELADIAKKGKPSMEKYVEEIEQRCKQNILAIEIQMKIK |
Source of smORF | Swiss-Prot |
Function | Stabilizes the phosphorylated form of DegU, leading to enhanced production of levansucrase, alkaline protease, and neutral protease. {ECO:0000269|Pubmed:1459944}. |
Pubmed ID | 3098734 8969496 9384377 1459944 8550420 9108277 |
Domain | |
Functional Category | Others |
Uniprot ID | P68731 |
ORF Length (Amino Acid) | 60 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 2308157 | 2308339 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
2 | 2185222 | 2185404 | - | NZ_CP048852.1 | Bacillus tequilensis |
3 | 2177430 | 2177612 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
4 | 2263766 | 2263948 | - | NZ_CP033052.1 | Bacillus vallismortis |
5 | 2117284 | 2117466 | - | NZ_CP013984.1 | Bacillus inaquosorum |
6 | 2106060 | 2106242 | - | NZ_CP051464.1 | Bacillus mojavensis |
7 | 3948322 | 3948504 | + | NZ_CP029364.1 | Bacillus halotolerans |
8 | 2283209 | 2283391 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
9 | 2384581 | 2384763 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
10 | 2490598 | 2490780 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
11 | 3368901 | 3369083 | + | NZ_CP017786.1 | Bacillus xiamenensis |
12 | 2010448 | 2010630 | - | NZ_CP011150.1 | Bacillus altitudinis |
13 | 3277908 | 3278090 | + | NZ_CP043404.1 | Bacillus safensis |
14 | 1805844 | 1806026 | + | NZ_CP011937.1 | Bacillus velezensis |
15 | 2149976 | 2150158 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF01966.24 | 0.6 | 9 | 3620 | same-strand | HD domain |
2 | PF00255.21 | 0.6 | 9 | 3122 | same-strand | Glutathione peroxidase |
3 | PF00578.23 | 0.6 | 9 | 3122 | same-strand | AhpC/TSA family |
4 | PF04204.18 | 1.0 | 15 | 1874 | opposite-strand | Homoserine O-succinyltransferase |
5 | PF06925.13 | 1.0 | 15 | 495 | opposite-strand | Monogalactosyldiacylglycerol (MGDG) synthase |
6 | PF00534.22 | 1.0 | 15 | 495 | opposite-strand | Glycosyl transferases group 1 |
7 | PF04101.18 | 1.0 | 15 | 495 | opposite-strand | Glycosyltransferase family 28 C-terminal domain |
8 | PF13692.8 | 1.0 | 15 | 495 | opposite-strand | Glycosyl transferases group 1 |
9 | PF00313.24 | 1.0 | 15 | 52 | opposite-strand | 'Cold-shock' DNA-binding domain |
10 | PF10819.10 | 0.8 | 12 | 157.5 | opposite-strand | Protein of unknown function (DUF2564) |
11 | PF10782.11 | 1.0 | 15 | 453 | same-strand | Zinc-finger |
12 | PF13456.8 | 1.0 | 15 | 709 | same-strand | Reverse transcriptase-like |
13 | PF02592.17 | 1.0 | 15 | 1392 | opposite-strand | Putative vitamin uptake transporter |
14 | PF00075.26 | 1.0 | 15 | 2071 | opposite-strand | RNase H |