Result : P68675
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Phi-Lf prophage-derived helix-destabilizing protein (Single-stranded DNA-binding protein) (SBP) |
| NCBI Accession ID | AE008922.1 |
| Organism | Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) |
| Left | 2437405 |
| Right | 2437701 |
| Strand | + |
| Nucleotide Sequence | ATGAAAGTGCAGATCATGAGTTCCGCTGTCGCTGTTCGTTCGTTCCCCGCGCGCGAGGGTAAGCCCGCGACGCATTTCCGTGAGCAGACCGCCGCTGTGCTGCGTGAGGGCGATTTCCCACTGCCGTTCACCATCGGTCTGGACGAGGATCAACCGCCGTATGGCGAGGGCTTCTACATCATCGATCCCAAGTCGTTGCAGAACAATAAATTCGGCGGTCTCGAGTTCGGCCGTCGCATTCGTCTGATTCCGGACCTCACTGCGAAGCTGCAACAGCAGCCCGCAAAGGTCGGGTGA |
| Sequence | MKVQIMSSAVAVRSFPAREGKPATHFREQTAAVLREGDFPLPFTIGLDEDQPPYGEGFYIIDPKSLQNNKFGGLEFGRRIRLIPDLTAKLQQQPAKVG |
| Source of smORF | Swiss-Prot |
| Function | Single-strand DNA-binding protein required for DNA replication. {ECO:0000250}. |
| Pubmed ID | 12024217 |
| Domain | CDD:396745 |
| Functional Category | DNA-binding |
| Uniprot ID | P68675 |
| ORF Length (Amino Acid) | 98 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 929158 | 929454 | + | NZ_CP016878.1 | Xanthomonas hortorum |
| 2 | 1740631 | 1740918 | - | NZ_CP046570.1 | Xanthomonas albilineans |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP016878.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF12472.10 | 1.0 | 2 | 1846.5 | opposite-strand | Phage related protein |
++ More..