ProsmORF-pred
Result : P68661
Protein Information
Information Type Description
Protein name Putative nuclease YbcO (EC 3.1.-.-)
NCBI Accession ID X92587.1
Organism Escherichia coli (strain K12)
Left 850
Right 1140
Strand +
Nucleotide Sequence ATGGCTGATTTGAGAAAAGCAGCGCGTGGTCGGGAATGCCAGGTAAGAATCCCTGGCGTATGTAATGGCAACCCTGAAACGTCTGTACTGGCACATATCCGGCTGACTGGATTGTGCGGCACCGGTACGAAACCGCCAGACCTGATTGCCACCATTGCATGTTCTGCCTGCCACGACGAAATCGACCGCCGCACGCATTTTGTTGACGCTGGATATGCAAAAGAATGCGCGCTGGAAGGTATGGCGAGAACACAGGTTATCTGGCTGAAAGAGGGGGTTATTAAGGCGTGA
Sequence MADLRKAARGRECQVRIPGVCNGNPETSVLAHIRLTGLCGTGTKPPDLIATIACSACHDEIDRRTHFVDAGYAKECALEGMARTQVIWLKEGVIKA
Source of smORF Swiss-Prot
Function Based on its fold and a conserved His residue, has been predicted to be a nuclease. {ECO:0000305|Pubmed:27562564}.
Pubmed ID 8648624 9278503 16738553 27562564
Domain CDD:377777
Functional Category Metal-binding
Uniprot ID P68661
ORF Length (Amino Acid) 96
++ More..
Conservation Analysis
Conservation Analysis
No. of Species: 47
Sr.No. Left Position Right Position Strand NCBI Accession id Species Name
1 573084 573374 + NC_000913.3 Escherichia coli str. K-12 substr. MG1655
2 1624934 1625224 + NC_002695.2 Escherichia coli O157:H7 str. Sakai
3 1939724 1940014 + NC_002695.2 Escherichia coli O157:H7 str. Sakai
4 1853001 1853291 + NZ_LR134340.1 Escherichia marmotae
5 3026897 3027187 - NZ_LR134340.1 Escherichia marmotae
6 2330774 2331064 - NZ_LR134340.1 Escherichia marmotae
7 1767941 1768231 - NZ_CP057657.1 Escherichia fergusonii
8 1364795 1365085 - NZ_CP057657.1 Escherichia fergusonii
9 2449392 2449682 - NZ_CP054058.1 Scandinavium goeteborgense
10 2651443 2651733 - NZ_CP012266.1 Cronobacter dublinensis subsp. dublinensis LMG 23823
11 3565009 3565299 - NZ_CP045205.1 Citrobacter telavivensis
12 2670992 2671282 - NZ_CP013990.1 Leclercia adecarboxylata
13 3048112 3048399 - NZ_CP012264.1 Cronobacter condimenti 1330
14 365082 365369 + NZ_CP027107.1 Cronobacter sakazakii
15 604567 604857 - NZ_CP026364.1 Proteus hauseri
16 213516 213806 - NZ_CP026364.1 Proteus hauseri
17 3889452 3889742 - NZ_CP029736.1 Providencia rettgeri
18 3024489 3024779 - NZ_CP032487.1 Yersinia hibernica
19 1522101 1522385 + NZ_CP032487.1 Yersinia hibernica
20 334795 335085 + NZ_FO704551.1 Xenorhabdus poinarii G6
21 1348994 1349284 + NZ_CP047349.1 Proteus terrae subsp. cibarius
22 541061 541351 + NC_010554.1 Proteus mirabilis HI4320
23 1599002 1599292 - NZ_CP029822.1 Entomomonas moraniae
24 1316527 1316817 - NZ_CP029822.1 Entomomonas moraniae
25 626986 627270 + NZ_CP016176.1 Xenorhabdus hominickii
26 1277556 1277840 - NZ_CP016176.1 Xenorhabdus hominickii
27 1480398 1480688 + NZ_CP042220.2 Dickeya poaceiphila
28 3261450 3261743 + NZ_CP019706.1 Pantoea alhagi
29 1041850 1042131 + NZ_CP028271.1 Mixta intestinalis
30 1687869 1688156 - NZ_CP028271.1 Mixta intestinalis
31 3513198 3513488 - NZ_LR134201.1 Cedecea lapagei
32 2116479 2116769 - NZ_LR134201.1 Cedecea lapagei
33 2705290 2705574 - NZ_CP011118.1 Yersinia enterocolitica
34 3088764 3089057 - NZ_CP014007.2 Kosakonia oryzae
35 907648 907944 + NZ_CP059567.1 Neisseria shayeganii
36 1342994 1343287 + NZ_LR134531.1 Pragia fontium
37 2932700 2932987 - NZ_CP034036.1 Brenneria nigrifluens DSM 30175 = ATCC 13028
38 2467576 2467872 + NZ_CP050508.1 Raoultella terrigena
39 1892315 1892599 - NZ_CP067057.1 Rahnella aceris
40 1290907 1291140 + NZ_CP009365.1 Pseudomonas soli
41 2766729 2767025 + NZ_CP060111.1 Klebsiella michiganensis
42 1459390 1459674 + NZ_CP061280.1 Mannheimia bovis
43 1399944 1400234 + NC_004337.2 Shigella flexneri 2a str. 301
44 903199 903489 - NC_004337.2 Shigella flexneri 2a str. 301
45 554401 554694 + NZ_CP007446.1 Snodgrassella alvi wkB2
46 2075038 2075331 - NZ_CP007446.1 Snodgrassella alvi wkB2
47 4312688 4312981 - NZ_CP040428.1 Jejubacter calystegiae
48 3212333 3212578 + NZ_CP040428.1 Jejubacter calystegiae
49 1840419 1840703 + NZ_CP048784.1 Serratia liquefaciens
50 3059782 3060072 + NZ_CP061527.1 Shigella dysenteriae
51 812573 812860 - NZ_CP009781.1 Yersinia aldovae 670-83
52 3245654 3245896 - NZ_CP050150.1 Hafnia alvei
53 1716454 1716699 - NZ_LS483443.1 Aggregatibacter segnis ATCC 33393
54 1535832 1536128 - NZ_CP019448.1 Simonsiella muelleri ATCC 29453
55 1125440 1125685 - NZ_CP049115.1 Pantoea stewartii
56 3659183 3659470 + NZ_CP065640.1 Serratia rubidaea
57 3010396 3010683 - NC_015567.1 Serratia plymuthica AS9
58 4477570 4477863 - NZ_CP007230.1 Yersinia similis
59 1358546 1358794 + NZ_CP011036.1 Pseudoalteromonas nigrifaciens
60 1920828 1921118 + NZ_CP009533.1 Pseudomonas rhizosphaerae
61 1560056 1560352 + NZ_CP027756.1 Pseudomonas synxantha
++ More..