Result : P68659
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Lambda prophage-derived head-to-tail joining protein W (gpW) |
| NCBI Accession ID | AE014075.1 |
| Organism | Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) |
| Left | 3043851 |
| Right | 3044057 |
| Strand | - |
| Nucleotide Sequence | ATGACGCGACAGGAAGAACTTGCCGCTGCCCGTGCGGCACTGCATGACCTGATGACAGGAAAACGGGTGGCAACAGTACAGAAAGACGGACGAAGGGTGGAGTTTACGGCCACTTCCGTGTCTGACCTGAAAAAATACATTGCGGAGCTGGAAGTGCAGACCGGCATGACACAGCGACGCAGGGGACCTGCAGGATTTTATGTATGA |
| Sequence | MTRQEELAAARAALHDLMTGKRVATVQKDGRRVEFTATSVSDLKKYIAELEVQTGMTQRRRGPAGFYV |
| Source of smORF | Swiss-Prot |
| Function | Required for the stabilization of DNA within the phage head and for attachment of tails onto the head during morphogenesis. {ECO:0000250}. |
| Pubmed ID | 12471157 |
| Domain | CDD:397116 |
| Functional Category | Others |
| Uniprot ID | P68659 |
| ORF Length (Amino Acid) | 68 |
++ More..
| Conservation Analysis |
No. of Species: 11
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 41874 | 42080 | + | NZ_CP068597.1 | Paenibacillus sonchi |
| 2 | 1863619 | 1863825 | + | NZ_LR134340.1 | Escherichia marmotae |
| 3 | 1757604 | 1757810 | - | NZ_CP057657.1 | Escherichia fergusonii |
| 4 | 1632663 | 1632869 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 5 | 2179560 | 2179766 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 6 | 1191965 | 1192171 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 7 | 2687173 | 2687379 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 8 | 2127447 | 2127653 | - | NZ_AP014857.1 | Escherichia albertii |
| 9 | 1997188 | 1997394 | - | NZ_AP014857.1 | Escherichia albertii |
| 10 | 2961184 | 2961390 | + | NZ_CP020388.1 | Pluralibacter gergoviae |
| 11 | 2681797 | 2682003 | - | NZ_CP009756.1 | Enterobacter cloacae |
| 12 | 1032799 | 1033005 | + | NZ_CP017279.1 | Enterobacter ludwigii |
| 13 | 2755401 | 2755604 | - | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 14 | 2569626 | 2569814 | - | NZ_CP050150.1 | Hafnia alvei |
| 15 | 728063 | 728266 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP068597.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF07471.14 | 0.91 | 10 | 1897 | same-strand | Phage DNA packaging protein Nu1 |
| 2 | PF05876.14 | 0.91 | 10 | -3.0 | same-strand | Phage terminase large subunit (GpA) |
| 3 | PF05136.15 | 1.0 | 11 | -3 | same-strand | Phage portal protein, lambda family |
| 4 | PF01343.20 | 1.0 | 11 | 1579 | same-strand | Peptidase family S49 |
| 5 | PF02924.16 | 1.0 | 11 | 2917 | same-strand | Bacteriophage lambda head decoration protein D |
| 6 | PF03864.17 | 1.0 | 11 | 3296 | same-strand | Phage major capsid protein E |
| 7 | PF14000.8 | 0.91 | 10 | 4363.0 | same-strand | DNA packaging protein FI |
++ More..