Protein Information |
Information Type | Description |
---|---|
Protein name | P21 prophage-derived head-stabilizing protein (Head protein gp3) |
NCBI Accession ID | AE014075.1 |
Organism | Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) |
Left | 1427364 |
Right | 1427570 |
Strand | + |
Nucleotide Sequence | ATGGTTACAGTCGCTGAACTGCAGGCGCTGCGTCAGGCGCGCCTTGATTTATTAACCGGTAAACGGGTGGTGTCTGTCCAGAAAGATGGTCGCAGAATTGAATATACGGCGGCTTCTCTGGATGAGCTTAACCGGGCGATCAATGATGCGGAGTCGGTACTGGGGACAACCCGGTGTCGCCGTCGTCCGCTGGGAGTGAGGTTATGA |
Sequence | MVTVAELQALRQARLDLLTGKRVVSVQKDGRRIEYTAASLDELNRAINDAESVLGTTRCRRRPLGVRL |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of pfam02831. Profile Description: gpW. gpW is a 68 residue protein known to be present in phage particles. Extracts of phage-infected cells lacking gpW contain DNA-filled heads, and active tails, but no infectious virions. gpW is required for the addition of gpFII to the head, which is, in turn, required for the attachment of tails. Since gpFII and tails are known to be attached at the connector, gpW is also likely to assemble at this site. The addition of gpW to filled heads increases the DNase resistance of the packaged DNA, suggesting that gpW either forms a plug at the connector to prevent ejection of the DNA, or binds directly to the DNA. The large number of positively charged residues in gpW (its calculated pI is 10.8) is consistent with a role in DNA interaction. |
Pubmed ID | 12471157 |
Domain | CDD:397116 |
Functional Category | Others |
Uniprot ID | P68655 |
ORF Length (Amino Acid) | 68 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1997188 | 1997394 | - | NZ_AP014857.1 | Escherichia albertii |
2 | 1191965 | 1192171 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
3 | 2687173 | 2687379 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
4 | 728063 | 728266 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
5 | 1032799 | 1033005 | + | NZ_CP017279.1 | Enterobacter ludwigii |
6 | 2755401 | 2755604 | - | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
7 | 2961184 | 2961390 | + | NZ_CP020388.1 | Pluralibacter gergoviae |
8 | 2681797 | 2682003 | - | NZ_CP009756.1 | Enterobacter cloacae |
9 | 2569626 | 2569814 | - | NZ_CP050150.1 | Hafnia alvei |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF14000.8 | 0.75 | 6 | 4398.5 | same-strand | DNA packaging protein FI |
2 | PF03864.17 | 0.88 | 7 | 3328 | same-strand | Phage major capsid protein E |
3 | PF02924.16 | 1.0 | 8 | 3076 | same-strand | Bacteriophage lambda head decoration protein D |
4 | PF01343.20 | 1.0 | 8 | 1579 | same-strand | Peptidase family S49 |
5 | PF05136.15 | 1.0 | 8 | -3 | same-strand | Phage portal protein, lambda family |
6 | PF05876.14 | 0.88 | 7 | -8.0 | same-strand | Phage terminase large subunit (GpA) |
7 | PF07471.14 | 0.62 | 5 | 1897 | same-strand | Phage DNA packaging protein Nu1 |