Result : P68577
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | SPbeta prophage-derived bacteriocin sublancin-168 |
| NCBI Accession ID | AF014938.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 2822 |
| Right | 2992 |
| Strand | + |
| Nucleotide Sequence | ATGGAAAAGCTATTTAAAGAAGTTAAACTAGAGGAACTCGAAAACCAAAAAGGTAGTGGATTAGGAAAAGCTCAGTGTGCTGCGTTGTGGCTACAATGTGCTAGTGGCGGTACAATTGGTTGTGGTGGCGGAGCTGTTGCTTGTCAAAACTATCGTCAATTCTGCAGATAA |
| Sequence | MEKLFKEVKLEELENQKGSGLGKAQCAALWLQCASGGTIGCGGGAVACQNYRQFCR |
| Source of smORF | Swiss-Prot |
| Function | Bacteriocin active against Gram-positive bacteria. Inhibits B.cereus spore outgrowth, after the germination stage, approximately 1000-fold better than it inhibits exponential growth of the same cells. Inhibits B.subtilis strain ATCC 6633. {ECO:0000269|Pubmed:21196935}. |
| Pubmed ID | 9722542 9384377 21251913 21196935 11872755 19047653 |
| Domain | CDD:211919,CDD:408921 |
| Functional Category | Antimicrobial |
| Uniprot ID | P68577 |
| ORF Length (Amino Acid) | 56 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2002935 | 2003105 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 2 | 2269521 | 2269691 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP013984.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02600.18 | 1.0 | 2 | 3851.5 | same-strand | Disulfide bond formation protein DsbB |
| 2 | PF13704.8 | 1.0 | 2 | 2586.5 | same-strand | Glycosyl transferase family 2 |
| 3 | PF00085.22 | 1.0 | 2 | 2173.5 | same-strand | Thioredoxin |
| 4 | PF13098.8 | 1.0 | 2 | 2173.5 | same-strand | Thioredoxin-like domain |
| 5 | PF13192.8 | 1.0 | 2 | 2173.5 | same-strand | Thioredoxin domain |
| 6 | PF00664.25 | 1.0 | 2 | 58.0 | same-strand | ABC transporter transmembrane region |
| 7 | PF03412.17 | 1.0 | 2 | 58.0 | same-strand | Peptidase C39 family |
| 8 | PF00005.29 | 1.0 | 2 | 58.0 | same-strand | ABC transporter |
| 9 | PF00817.22 | 1.0 | 2 | 717.0 | same-strand | impB/mucB/samB family |
| 10 | PF11799.10 | 1.0 | 2 | 717.0 | same-strand | impB/mucB/samB family C-terminal domain |
| 11 | PF11798.10 | 1.0 | 2 | 717.0 | same-strand | IMS family HHH motif |
| 12 | PF08863.12 | 1.0 | 2 | 1957.0 | same-strand | YolD-like protein |
++ More..