Result : P67699
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized HTH-type transcriptional regulator YddM |
| NCBI Accession ID | U00096.3 |
| Organism | Escherichia coli (strain K12) |
| Left | 1552398 |
| Right | 1552682 |
| Strand | - |
| Nucleotide Sequence | ATGAAAATGGCCAATCATCCCCGCCCGGGGGACATTATTCAGGAATCACTGGACGAACTTAATGTCAGCCTGCGCGAGTTTGCCAGAGCAATGGAAATTGCTCCCTCAACGGCAAGCCGATTGCTGACAGGAAAAGCAGCTTTGACGCCAGAAATGGCGATTAAACTTTCCGTGGTGATCGGCAGTTCGCCGCAAATGTGGCTGAATCTGCAAAACGCCTGGAGTCTGGCAGAGGCAGAAAAAACAGTGGATGTGTCGCGATTACGCCGTCTGGTTACGCAATAA |
| Sequence | MKMANHPRPGDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQNAWSLAEAEKTVDVSRLRRLVTQ |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl22854. Profile Description: N/A. YdaS_antitoxin is a family of putative bacterial antitoxins, neutralising the toxin YdaT, family pfam06254. |
| Pubmed ID | 9278503 16738553 |
| Domain | CDD:419869 |
| Functional Category | DNA-binding |
| Uniprot ID | P67699 |
| ORF Length (Amino Acid) | 94 |
++ More..
| Conservation Analysis |
No. of Species: 26
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1552398 | 1552682 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 2 | 2207712 | 2207996 | + | NZ_LR134340.1 | Escherichia marmotae |
| 3 | 520885 | 521169 | - | NZ_CP057657.1 | Escherichia fergusonii |
| 4 | 1541834 | 1542118 | - | NZ_AP014857.1 | Escherichia albertii |
| 5 | 2136104 | 2136388 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 6 | 1784801 | 1785085 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 7 | 2073778 | 2074062 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 8 | 3791696 | 3791980 | + | NZ_LT556085.1 | Citrobacter amalonaticus |
| 9 | 3156019 | 3156303 | - | NZ_CP045205.1 | Citrobacter telavivensis |
| 10 | 1654646 | 1654930 | + | NC_013716.1 | Citrobacter rodentium ICC168 |
| 11 | 4874000 | 4874284 | - | NZ_CP044098.1 | Citrobacter portucalensis |
| 12 | 2285269 | 2285559 | + | NZ_CP054058.1 | Scandinavium goeteborgense |
| 13 | 215991 | 216275 | + | NZ_AP023184.1 | Buttiauxella agrestis |
| 14 | 2469818 | 2470120 | - | NC_005126.1 | Photorhabdus laumondii subsp. laumondii TTO1 |
| 15 | 2158150 | 2158449 | + | NZ_CP011104.1 | Photorhabdus thracensis |
| 16 | 1844262 | 1844546 | + | NZ_CP011254.1 | Serratia fonticola |
| 17 | 2864214 | 2864516 | + | NC_012962.1 | Photorhabdus asymbiotica |
| 18 | 5339613 | 5339897 | - | NZ_CP014137.1 | Brenneria goodwinii |
| 19 | 862193 | 862477 | - | NZ_CP034036.1 | Brenneria nigrifluens DSM 30175 = ATCC 13028 |
| 20 | 508371 | 508676 | - | NZ_CP011118.1 | Yersinia enterocolitica |
| 21 | 4006378 | 4006614 | + | NZ_CP071320.1 | Serratia ureilytica |
| 22 | 3086684 | 3086983 | + | NC_014306.1 | Erwinia billingiae Eb661 |
| 23 | 1084785 | 1085021 | - | NZ_LR134494.1 | Serratia quinivorans |
| 24 | 2129024 | 2129302 | + | NZ_CP012257.1 | Cronobacter universalis NCTC 9529 |
| 25 | 1307999 | 1308277 | - | NZ_CP027107.1 | Cronobacter sakazakii |
| 26 | 2088769 | 2089047 | - | NZ_CP013940.1 | Cronobacter malonaticus LMG 23826 |
| 27 | 818641 | 818913 | + | NZ_CP040428.1 | Jejubacter calystegiae |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_AP014857.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF05015.15 | 0.65 | 17 | 0 | same-strand | RelE-like toxin of type II toxin-antitoxin system HigB |
++ More..