Result : P67379
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Cell division protein CrgA |
| NCBI Accession ID | BX251410.1 |
| Organism | Tropheryma whipplei (strain TW08/27) (Whipple's bacillus) |
| Left | 11133 |
| Right | 11342 |
| Strand | - |
| Nucleotide Sequence | ATGAGCAGAAAAAAACACGAGTCCAGCGAAAATAACCCCGTGTGGTTTCCGACAATTATGTTCGGGCTTATGGGCACCGGGGCTGTGTGGATGGTTCTGTTCTACATTTCCAACGGCGCCTTGCCTCTGCCGGCGGTCGGAACATGGAATATCCTCATAGCGTTCGGAATAATCATGGCCGGATTTGCAATGATGTCACGCTGGAAGTAA |
| Sequence | MSRKKHESSENNPVWFPTIMFGLMGTGAVWMVLFYISNGALPLPAVGTWNILIAFGIIMAGFAMMSRWK |
| Source of smORF | Swiss-Prot |
| Function | Involved in cell division. {ECO:0000255|HAMAP-Rule:MF_00631}. |
| Pubmed ID | 12606174 |
| Domain | CDD:416303 |
| Functional Category | Others |
| Uniprot ID | P67379 |
| ORF Length (Amino Acid) | 69 |
++ More..
| Conservation Analysis |
No. of Species: 4
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 11133 | 11342 | - | NC_004572.3 | Tropheryma whipplei str. Twist |
| 2 | 14242 | 14412 | - | NZ_CP071883.1 | Curtobacterium flaccumfaciens pv. flaccumfaciens |
| 3 | 1568086 | 1568259 | - | NZ_CP018863.1 | Arthrobacter crystallopoietes |
| 4 | 1103552 | 1103722 | + | NZ_CP061344.1 | Microbacterium hominis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP071883.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01694.24 | 1.0 | 4 | 249.0 | opposite-strand | Rhomboid family |
| 2 | PF00117.30 | 1.0 | 4 | 694.5 | opposite-strand | Glutamine amidotransferase class-I |
| 3 | PF00160.23 | 0.75 | 3 | 1212 | opposite-strand | Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD |
| 4 | PF00069.27 | 0.75 | 3 | 2497.5 | same-strand | Protein kinase domain |
| 5 | PF03793.21 | 0.75 | 3 | 1965 | same-strand | PASTA domain |
| 6 | PF07714.19 | 0.75 | 3 | 2497.5 | same-strand | Protein tyrosine and serine/threonine kinase |
++ More..