Result : P66460
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 30S ribosomal protein S18 |
| NCBI Accession ID | AE001439.1 |
| Organism | Helicobacter pylori (strain J99 / ATCC 700824) (Campylobacter pylori J99) |
| Left | 1299303 |
| Right | 1299560 |
| Strand | - |
| Nucleotide Sequence | ATGGAAAGAAAACGCTATTCAAAACGCTATTGCAAATACACTGAAGCTAAAATCAGCTTTATTGACTATAAAGATTTAGACATGCTCAAGCACACGCTATCAGAGCGCTATAAAATCATGCCAAGGAGGTTGACAGGCAATAGCAAAAAGTGGCAAGAGAGGGTGGAAGTGGCGATCAAAAGAGCCCGCCACATGGCTTTAATCCCCTACATTGTGGATAGGAAAAAGGTCGTGGATAGCCCTTTTAAACAGCACTGA |
| Sequence | MERKRYSKRYCKYTEAKISFIDYKDLDMLKHTLSERYKIMPRRLTGNSKKWQERVEVAIKRARHMALIPYIVDRKKVVDSPFKQH |
| Source of smORF | Swiss-Prot |
| Function | Binds as a heterodimer with protein S6 to the central domain of the 16S rRNA, where it helps stabilize the platform of the 30S subunit. {ECO:0000255|HAMAP-Rule:MF_00270}. |
| Pubmed ID | 9923682 |
| Domain | CDD:412341 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | P66460 |
| ORF Length (Amino Acid) | 85 |
++ More..
| Conservation Analysis |
No. of Species: 128
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1309271 | 1309528 | - | NC_017379.1 | Helicobacter pylori Puno135 |
| 2 | 70047 | 70304 | - | NC_017735.1 | Helicobacter cetorum MIT 99-5656 |
| 3 | 208275 | 208532 | + | NC_008229.1 | Helicobacter acinonychis str. Sheeba |
| 4 | 493597 | 493851 | - | NZ_LN907858.1 | Helicobacter typhlonius |
| 5 | 1368652 | 1368906 | - | NZ_LS483446.1 | Helicobacter mustelae |
| 6 | 1763008 | 1763265 | - | NC_005090.1 | Wolinella succinogenes DSM 1740 |
| 7 | 1485435 | 1485692 | - | NZ_CP021886.1 | Helicobacter apodemus |
| 8 | 1056205 | 1056459 | - | NC_014810.2 | Helicobacter felis ATCC 49179 |
| 9 | 193274 | 193531 | + | NZ_CP063087.1 | Helicobacter winghamensis |
| 10 | 519396 | 519650 | + | NC_004917.1 | Helicobacter hepaticus ATCC 51449 |
| 11 | 399729 | 399983 | - | NZ_AP018676.1 | Helicobacter cinaedi |
| 12 | 423718 | 423972 | + | NZ_CP014991.1 | Helicobacter himalayensis |
| 13 | 1675150 | 1675410 | + | NZ_CP020867.1 | Campylobacter cuniculorum DSM 23162 = LMG 24588 |
| 14 | 1006100 | 1006360 | + | NC_002163.1 | Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819 |
| 15 | 326965 | 327225 | - | NZ_CP031611.1 | Campylobacter hepaticus |
| 16 | 424044 | 424304 | - | NZ_CP053849.1 | Campylobacter upsaliensis RM3940 |
| 17 | 589259 | 589513 | + | NZ_CP022347.1 | Campylobacter avium LMG 24591 |
| 18 | 877174 | 877434 | + | NZ_CP007770.1 | Campylobacter insulaenigrae NCTC 12927 |
| 19 | 912937 | 913197 | + | NC_012039.1 | Campylobacter lari RM2100 |
| 20 | 413967 | 414227 | - | NZ_CP020478.1 | Campylobacter helveticus |
| 21 | 894899 | 895159 | + | NZ_CP007774.1 | Campylobacter volucris LMG 24379 |
| 22 | 11169 | 11429 | + | NZ_CP063079.1 | Campylobacter peloridis |
| 23 | 954325 | 954585 | + | NZ_CP053825.1 | Campylobacter armoricus |
| 24 | 999331 | 999591 | + | NZ_CP053848.1 | Campylobacter ornithocola |
| 25 | 1209566 | 1209844 | + | NZ_AP022847.1 | Nitrosophilus alvini |
| 26 | 1187271 | 1187531 | + | NZ_CP007773.1 | Campylobacter subantarcticus LMG 24377 |
| 27 | 622427 | 622699 | - | NZ_AP022826.1 | Nitrosophilus labii |
| 28 | 1132395 | 1132655 | + | NZ_CP059443.1 | Campylobacter fetus |
| 29 | 1246595 | 1246855 | + | NZ_CP053828.1 | Campylobacter hyointestinalis subsp. lawsonii |
| 30 | 705733 | 705993 | - | NZ_CP015578.1 | Campylobacter lanienae NCTC 13004 |
| 31 | 731245 | 731505 | - | NZ_CP053826.1 | Campylobacter curvus |
| 32 | 1237396 | 1237656 | + | NZ_CP010995.1 | Campylobacter iguaniorum |
| 33 | 1848201 | 1848464 | + | NC_014935.1 | Nitratifractor salsuginis DSM 16511 |
| 34 | 164340 | 164600 | + | NZ_CP035946.1 | Campylobacter canadensis |
| 35 | 1000786 | 1001046 | - | NZ_CP053831.1 | Campylobacter mucosalis |
| 36 | 1498787 | 1499047 | + | NZ_CP012547.1 | Campylobacter pinnipediorum subsp. pinnipediorum |
| 37 | 1520621 | 1520881 | - | NZ_CP012196.1 | Campylobacter gracilis |
| 38 | 627241 | 627501 | - | NZ_CP053841.1 | Campylobacter blaseri |
| 39 | 1809950 | 1810213 | + | NZ_CP063164.1 | Sulfurovum indicum |
| 40 | 1317382 | 1317642 | + | NZ_CP012541.1 | Campylobacter concisus |
| 41 | 973204 | 973464 | - | NZ_CP012543.1 | Campylobacter rectus |
| 42 | 762813 | 763073 | - | NZ_CP012544.1 | Campylobacter showae |
| 43 | 2276890 | 2277099 | - | NZ_CP035928.1 | Malaciobacter pacificus |
| 44 | 437626 | 437886 | + | NZ_CP019684.1 | Campylobacter sputorum bv. paraureolyticus LMG 11764 |
| 45 | 1851324 | 1851587 | + | NZ_CP011308.1 | Sulfurovum lithotrophicum |
| 46 | 1030067 | 1030330 | + | NZ_CP053842.1 | Campylobacter corcagiensis |
| 47 | 308075 | 308293 | + | NZ_CP030944.1 | Arcobacter aquimarinus |
| 48 | 364353 | 364571 | + | NZ_CP053833.1 | Arcobacter cloacae |
| 49 | 377770 | 377988 | + | NZ_CP032097.1 | Arcobacter ellisii |
| 50 | 369461 | 369679 | + | NZ_CP053835.1 | Arcobacter defluvii |
| 51 | 409258 | 409476 | + | NZ_CP042652.1 | Pseudoarcobacter acticola |
| 52 | 2531012 | 2531221 | - | NZ_CP019070.1 | Poseidonibacter parvus |
| 53 | 226765 | 226983 | + | NC_017187.1 | Aliarcobacter butzleri ED-1 |
| 54 | 326816 | 327034 | + | NZ_CP032100.1 | Arcobacter suis CECT 7833 |
| 55 | 375782 | 376000 | + | NZ_CP053840.1 | Arcobacter venerupis |
| 56 | 2856450 | 2856659 | - | NC_014166.1 | Arcobacter nitrofigilis DSM 7299 |
| 57 | 1707215 | 1707481 | + | NZ_AP014724.1 | Sulfurospirillum cavolei |
| 58 | 2645828 | 2646037 | - | NZ_CP041070.1 | Arcobacter anaerophilus |
| 59 | 861589 | 861855 | - | NC_013512.1 | Sulfurospirillum deleyianum DSM 6946 |
| 60 | 895015 | 895281 | - | NC_018002.1 | Sulfurospirillum barnesii SES-3 |
| 61 | 1152466 | 1152732 | - | NZ_CP017111.1 | Sulfurospirillum halorespirans DSM 13726 |
| 62 | 1075244 | 1075510 | - | NZ_CP007201.1 | Sulfurospirillum multivorans DSM 12446 |
| 63 | 2456986 | 2457195 | - | NZ_CP032098.1 | Malaciobacter molluscorum LMG 25693 |
| 64 | 2443668 | 2443877 | - | NZ_CP031218.1 | Malaciobacter halophilus |
| 65 | 2736989 | 2737198 | - | NZ_CP053836.1 | Halarcobacter ebronensis |
| 66 | 221178 | 221396 | + | NZ_CP032823.1 | Aliarcobacter cryaerophilus ATCC 43158 |
| 67 | 2475763 | 2475978 | - | NZ_CP042812.1 | Malaciobacter canalis |
| 68 | 2551444 | 2551659 | - | NZ_CP032101.1 | Malaciobacter marinus |
| 69 | 1705729 | 1705947 | - | NZ_CP031367.1 | Aliarcobacter trophiarum LMG 25534 |
| 70 | 2337953 | 2338162 | - | NZ_CP031217.1 | Halarcobacter bivalviorum |
| 71 | 1795832 | 1796050 | - | NZ_CP036246.2 | [Arcobacter] porcinus |
| 72 | 2018825 | 2019043 | - | NZ_CP053837.1 | Aliarcobacter faecis |
| 73 | 1995569 | 1995787 | - | NZ_CP054051.1 | Aliarcobacter cibarius |
| 74 | 2475341 | 2475550 | - | NZ_CP031219.1 | Malaciobacter mytili LMG 24559 |
| 75 | 1721850 | 1722068 | - | NZ_CP032099.1 | Aliarcobacter skirrowii CCUG 10374 |
| 76 | 1745070 | 1745333 | + | NC_007575.1 | Sulfurimonas denitrificans DSM 1251 |
| 77 | 729740 | 730003 | + | NZ_AP023212.1 | Hydrogenimonas urashimensis |
| 78 | 1289551 | 1289778 | - | NZ_CP027432.2 | Caminibacter pacificus |
| 79 | 688817 | 689044 | + | NZ_CP040463.1 | Caminibacter mediatlanticus TB-2 |
| 80 | 1261230 | 1261460 | - | NC_012115.1 | Nautilia profundicola AmH |
| 81 | 1698161 | 1698424 | + | NC_014506.1 | Sulfurimonas autotrophica DSM 16294 |
| 82 | 1594096 | 1594359 | + | NZ_CP041406.1 | Sulfurimonas paralvinellae |
| 83 | 141663 | 141881 | - | NZ_CP046314.1 | Gemella morbillorum |
| 84 | 1709253 | 1709471 | - | NZ_LR134484.1 | Gemella haemolysans |
| 85 | 3221645 | 3221899 | + | NZ_CP029480.1 | Arcticibacterium luteifluviistationis |
| 86 | 664463 | 664720 | - | NC_014762.1 | Sulfuricurvum kujiense DSM 16994 |
| 87 | 6248475 | 6248726 | - | NC_015703.1 | Runella slithyformis DSM 19594 |
| 88 | 254177 | 254404 | + | NZ_CP039710.1 | Thermoactinomyces vulgaris |
| 89 | 3411417 | 3411671 | - | NC_014655.1 | Leadbetterella byssophila DSM 17132 |
| 90 | 3264952 | 3265188 | - | NZ_CP016538.2 | Planococcus maritimus |
| 91 | 3266981 | 3267217 | - | NZ_CP059540.1 | Planococcus maritimus |
| 92 | 3171906 | 3172142 | - | NZ_CP013659.2 | Planococcus rifietoensis |
| 93 | 4068700 | 4068933 | - | NZ_CP024109.1 | Bacillus cytotoxicus |
| 94 | 3245955 | 3246191 | - | NZ_CP016539.2 | Planococcus plakortidis |
| 95 | 3541208 | 3541435 | - | NZ_CP048103.1 | Kroppenstedtia eburnea |
| 96 | 3320085 | 3320312 | - | NZ_CP048104.1 | Kroppenstedtia pulmonis |
| 97 | 2345731 | 2345973 | - | NZ_CP054482.1 | Macrococcus bohemicus |
| 98 | 2686490 | 2686717 | - | NZ_CP034118.1 | Staphylospora marina |
| 99 | 3289883 | 3290119 | - | NZ_CP016543.2 | Planococcus donghaensis |
| 100 | 3409231 | 3409467 | - | NZ_CP016537.2 | Planococcus halocryophilus |
| 101 | 1778643 | 1778879 | + | NZ_CP013661.2 | Planococcus kocurii |
| 102 | 3480364 | 3480600 | - | NZ_CP019401.1 | Planococcus faecalis |
| 103 | 3749924 | 3750160 | - | NZ_CP016534.2 | Planococcus antarcticus DSM 14505 |
| 104 | 3021767 | 3021997 | - | NC_010556.1 | Exiguobacterium sibiricum 255-15 |
| 105 | 35175 | 35414 | + | NC_013891.1 | Listeria seeligeri serovar 1/2b str. SLCC3954 |
| 106 | 103955 | 104194 | + | NZ_CP009577.1 | Listeria ivanovii subsp. ivanovii |
| 107 | 50514 | 50753 | + | NC_003210.1 | Listeria monocytogenes EGD-e |
| 108 | 33916 | 34155 | + | NZ_LR134483.1 | Listeria grayi |
| 109 | 2724947 | 2725156 | - | NZ_AP024085.1 | Faecalibacillus intestinalis |
| 110 | 959989 | 960231 | + | NZ_CP066042.1 | Staphylococcus saccharolyticus |
| 111 | 3234204 | 3234440 | - | NZ_CP016540.2 | Planococcus versutus |
| 112 | 3611401 | 3611628 | - | NZ_CP019699.1 | Novibacillus thermophilus |
| 113 | 363198 | 363440 | + | NZ_LR134304.1 | Staphylococcus schweitzeri |
| 114 | 361502 | 361744 | + | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 115 | 2699284 | 2699514 | - | NC_014614.1 | Acetoanaerobium sticklandii |
| 116 | 101030 | 101254 | + | NZ_CP024969.1 | Mesoplasma tabanidae |
| 117 | 27959 | 28183 | + | NZ_CP011361.2 | Salimicrobium jeotgali |
| 118 | 3390701 | 3390946 | - | NC_015172.1 | Syntrophobotulus glycolicus DSM 8271 |
| 119 | 1236113 | 1236340 | + | NC_015275.1 | Cellulosilyticum lentocellum DSM 5427 |
| 120 | 1882127 | 1882360 | + | NC_016630.1 | Filifactor alocis ATCC 35896 |
| 121 | 654614 | 654847 | + | NC_014720.1 | Caldicellulosiruptor kronotskyensis 2002 |
| 122 | 709588 | 709821 | + | NC_014652.1 | Caldicellulosiruptor hydrothermalis 108 |
| 123 | 2222500 | 2222733 | - | NC_012034.1 | Caldicellulosiruptor bescii DSM 6725 |
| 124 | 1960300 | 1960536 | - | NC_015949.1 | Caldicellulosiruptor lactoaceticus 6A |
| 125 | 531606 | 531842 | + | NC_014721.1 | Caldicellulosiruptor kristjanssonii I77R1B |
| 126 | 707857 | 708099 | + | NZ_AP017470.1 | Thermotomaculum hydrothermale |
| 127 | 89387 | 89614 | + | NZ_LT635480.1 | Ndongobacter massiliensis |
| 128 | 1660708 | 1660932 | + | NC_019940.1 | Thioflavicoccus mobilis 8321 |
| 129 | 1792536 | 1792763 | + | NC_011831.1 | Chloroflexus aggregans DSM 9485 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_017379.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00436.27 | 0.95 | 121 | 37.5 | same-strand | Single-strand binding protein family |
| 2 | PF01250.19 | 0.98 | 126 | 577 | same-strand | Ribosomal protein S6 |
++ More..