Result : P66267
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L35 |
| NCBI Accession ID | AE001273.1 |
| Organism | Chlamydia trachomatis (strain D/UW-3/Cx) |
| Left | 982710 |
| Right | 982904 |
| Strand | + |
| Nucleotide Sequence | ATGCCCAAGATGAAAAGCAATAAGTCCGTTGCGGCGCGTTTCAAATTGACTGGTTCTGGTCAATTAAAAAGAACTCGTCCGGGGAAAAGACACAAATTATCAAAAAGATCTTCGCAACAGAAACGCAACCTGTCTAAACAGCCTTTAGTGGATCAAGGTCAGGTGGGCATGTATAAGCGAATGATGCTCGTTTAA |
| Sequence | MPKMKSNKSVAARFKLTGSGQLKRTRPGKRHKLSKRSSQQKRNLSKQPLVDQGQVGMYKRMMLV |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00392. Profile Description: Ribosomal protein L35. This ribosomal protein is found in bacteria and organelles only. It is not closely related to any eukaryotic or archaeal ribosomal protein. [Protein synthesis, Ribosomal proteins: synthesis and modification] |
| Pubmed ID | 9784136 |
| Domain | CDD:412354 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | P66267 |
| ORF Length (Amino Acid) | 64 |
++ More..
| Conservation Analysis |
No. of Species: 36
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 982710 | 982904 | + | NC_000117.1 | Chlamydia trachomatis D/UW-3/CX |
| 2 | 261754 | 261948 | + | NC_002620.2 | Chlamydia muridarum str. Nigg |
| 3 | 1040927 | 1041121 | + | NZ_LS398098.1 | Chlamydia suis |
| 4 | 289727 | 289921 | + | NC_007899.1 | Chlamydia felis Fe/C-56 |
| 5 | 879816 | 880010 | - | NC_017287.1 | Chlamydia psittaci 6BC |
| 6 | 880607 | 880801 | - | NC_003361.3 | Chlamydia caviae GPIC |
| 7 | 1136123 | 1136317 | + | NC_005043.1 | Chlamydia pneumoniae TW-183 |
| 8 | 154738 | 154932 | - | NZ_CP015840.1 | Chlamydia gallinacea 08-1274/3 |
| 9 | 838834 | 839028 | - | NC_022439.1 | Chlamydia pecorum PV3056/3 |
| 10 | 1425112 | 1425306 | + | NC_015702.1 | Parachlamydia acanthamoebae UV-7 |
| 11 | 984188 | 984385 | + | NC_014225.1 | Waddlia chondrophila WSU 86-1044 |
| 12 | 1440403 | 1440600 | - | NZ_CP012395.1 | Clostridium autoethanogenum DSM 10061 |
| 13 | 3767216 | 3767413 | - | NC_014328.1 | Clostridium ljungdahlii DSM 13528 |
| 14 | 640598 | 640795 | + | NZ_AP023367.1 | Anaerocolumna cellulosilytica |
| 15 | 1801998 | 1802195 | + | NZ_CP048000.1 | Anaerocolumna sedimenticola |
| 16 | 2573233 | 2573442 | - | NZ_AP017378.1 | Desulfovibrio ferrophilus |
| 17 | 3199059 | 3199256 | - | NC_011837.1 | Clostridium kluyveri NBRC 12016 |
| 18 | 964794 | 964991 | + | NC_008593.1 | Clostridium novyi NT |
| 19 | 1713839 | 1714036 | - | NZ_CP006828.1 | Ornithobacterium rhinotracheale ORT-UMN 88 |
| 20 | 868506 | 868703 | + | NZ_CP032416.1 | Clostridium fermenticellae |
| 21 | 859193 | 859390 | + | NZ_CP014170.1 | Clostridium tyrobutyricum |
| 22 | 2927688 | 2927885 | + | NZ_CP071376.1 | Clostridium gasigenes |
| 23 | 3049653 | 3049850 | + | NZ_CP071376.1 | Clostridium gasigenes |
| 24 | 4260283 | 4260480 | - | NZ_CP026363.1 | Brevibacillus agri |
| 25 | 893027 | 893224 | + | NZ_CP007452.1 | Peptoclostridium acidaminophilum DSM 3953 |
| 26 | 871979 | 872176 | + | NC_016629.1 | Desulfocurvibacter africanus subsp. africanus str. Walvis Bay |
| 27 | 1848341 | 1848541 | + | NZ_AP019400.1 | Cohnella abietis |
| 28 | 4509298 | 4509495 | - | NZ_LR134338.1 | Brevibacillus brevis |
| 29 | 2047182 | 2047391 | + | NZ_AP021898.1 | Akkermansia muciniphila |
| 30 | 1050073 | 1050273 | + | NC_019897.1 | Thermobacillus composti KWC4 |
| 31 | 2354826 | 2355023 | - | NZ_CP036259.1 | Sporomusa termitida |
| 32 | 1999744 | 1999941 | - | NZ_CP012621.1 | Zobellella denitrificans |
| 33 | 2002525 | 2002722 | - | NZ_LR590481.1 | Hathewaya histolytica |
| 34 | 1400590 | 1400790 | - | NZ_AP014945.1 | Caldimicrobium thiodismutans |
| 35 | 3604213 | 3604410 | - | NZ_AP017312.1 | Aneurinibacillus soli |
| 36 | 2116044 | 2116241 | - | NZ_CP017253.2 | Clostridium taeniosporum |
| 37 | 2472260 | 2472457 | - | NC_015687.1 | Clostridium acetobutylicum DSM 1731 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000117.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00707.24 | 0.89 | 32 | 21 | same-strand | Translation initiation factor IF-3, C-terminal domain |
| 2 | PF05198.18 | 0.78 | 28 | 22 | same-strand | Translation initiation factor IF-3, N-terminal domain |
| 3 | PF00453.20 | 1.0 | 36 | 30 | same-strand | Ribosomal protein L20 |
| 4 | PF01409.22 | 0.72 | 26 | 526 | same-strand | tRNA synthetases class II core domain (F) |
| 5 | PF02912.20 | 0.72 | 26 | 506.5 | same-strand | Aminoacyl tRNA synthetase class II, N-terminal domain |
++ More..