| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Protein bdm homolog |
| NCBI Accession ID | |
| Organism | Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | |
| Sequence | MFTYYQAENSTAEPALVNAIEQGLRAEHGVVTEDDILMELTKWVEASDNDILSDIYQQTINYVVSGQHPTL |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl26498. Profile Description: Putative biofilm-dependent modulation protein. biofilm-dependent modulation protein; Provisional |
| Pubmed ID | 12471157 |
| Domain | CDD:331319 |
| Functional Category | Others |
| Uniprot ID | P65639 |
| ORF Length (Amino Acid) | 71 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2077445 | 2077660 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 2 | 1556065 | 1556280 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 3 | 524861 | 525076 | - | NZ_CP057657.1 | Escherichia fergusonii |
| 4 | 2203809 | 2204024 | + | NZ_LR134340.1 | Escherichia marmotae |
| 5 | 4040223 | 4040438 | + | NZ_CP053416.1 | Salmonella bongori |
| 6 | 1645174 | 1645389 | + | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 7 | 1651876 | 1652091 | + | NC_013716.1 | Citrobacter rodentium ICC168 |
| 8 | 1190160 | 1190378 | + | NZ_CP023529.1 | Lelliottia amnigena |
| 9 | 2418023 | 2418238 | - | NZ_CP013990.1 | Leclercia adecarboxylata |
| 10 | 1632469 | 1632684 | + | NZ_CP017279.1 | Enterobacter ludwigii |
| 11 | 294375 | 294590 | + | NZ_AP019007.1 | Enterobacter oligotrophicus |
| 12 | 2420449 | 2420664 | + | NZ_CP009756.1 | Enterobacter cloacae |
| 13 | 2382095 | 2382310 | + | NZ_AP022508.1 | Enterobacter bugandensis |
| 14 | 2373616 | 2373831 | + | NZ_CP017184.1 | Enterobacter roggenkampii |
| 15 | 150186 | 150401 | - | NZ_CP025034.2 | Enterobacter sp. SGAir0187 |
| 16 | 2639812 | 2640027 | + | NZ_CP043318.1 | Enterobacter chengduensis |
| 17 | 1061250 | 1061465 | - | NZ_CP045769.1 | Enterobacter cancerogenus |
| 18 | 2375309 | 2375524 | + | NZ_CP027986.1 | Enterobacter sichuanensis |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF08240.14 | 0.82 | 14 | 4345 | same-strand | Alcohol dehydrogenase GroES-like domain |
| 2 | PF00107.28 | 0.82 | 14 | 4345 | same-strand | Zinc-binding dehydrogenase |
| 3 | PF13602.8 | 0.82 | 14 | 4345 | same-strand | Zinc-binding dehydrogenase |
| 4 | PF03949.17 | 1.0 | 17 | 409.5 | same-strand | Malic enzyme, NAD binding domain |
| 5 | PF00390.21 | 1.0 | 17 | 409.5 | same-strand | Malic enzyme, N-terminal domain |
| 6 | PF08136.13 | 1.0 | 17 | 96.0 | same-strand | 30S ribosomal protein subunit S22 family |
| 7 | PF02566.21 | 1.0 | 17 | 2152.0 | opposite-strand | OsmC-like protein |
| 8 | PF00005.29 | 0.71 | 12 | 2470.0 | same-strand | ABC transporter |
| 9 | PF03466.22 | 0.71 | 12 | 1309.0 | opposite-strand | LysR substrate binding domain |
| 10 | PF00126.29 | 0.71 | 12 | 1309.0 | opposite-strand | Bacterial regulatory helix-turn-helix protein, lysR family |