Result : P65038
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein Mb2668 |
| NCBI Accession ID | LT708304.1 |
| Organism | Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) |
| Left | 2934343 |
| Right | 2934585 |
| Strand | + |
| Nucleotide Sequence | ATGGTCGCCGCGGATCATCGAGCACTCGGCAGCAACAAATCCTATCCCGCCTCGCAGACGGCGGAGGCCATTTGGCCGCCGGCGCGTACTCTTCGCTACGACCGCCAGAGCCCTTGGTTAGCGACCGGATTCGACCGCCGCATGAGCCAAACTGTTACCGGTGTGGGTGTGCAGAACTGCGCAGTTAGCAAACGCCGATGCAGCGCGGTGGACCACAGCAGCCGCACACCGTACCGGCGCTGA |
| Sequence | MVAADHRALGSNKSYPASQTAEAIWPPARTLRYDRQSPWLATGFDRRMSQTVTGVGVQNCAVSKRRCSAVDHSSRTPYRR |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 12788972 28385856 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | P65038 |
| ORF Length (Amino Acid) | 80 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2962470 | 2962712 | + | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
| 2 | 3033708 | 3033950 | + | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000962.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01139.19 | 1.0 | 2 | 3600.5 | same-strand | tRNA-splicing ligase RtcB |
| 2 | PF08962.13 | 1.0 | 2 | 3280.5 | opposite-strand | Domain of unknown function (DUF1876) |
| 3 | PF01814.25 | 1.0 | 2 | 2650.0 | opposite-strand | Hemerythrin HHE cation binding domain |
| 4 | PF00934.22 | 1.0 | 2 | 29.0 | opposite-strand | PE family |
| 5 | PF07931.14 | 1.0 | 2 | 49.0 | same-strand | Chloramphenicol phosphotransferase-like protein |
| 6 | PF09335.13 | 1.0 | 2 | 874.0 | same-strand | SNARE associated Golgi protein |
| 7 | PF01740.23 | 1.0 | 2 | 1693.0 | same-strand | STAS domain |
| 8 | PF13466.8 | 1.0 | 2 | 1693.0 | same-strand | STAS domain |
| 9 | PF02694.17 | 1.0 | 2 | 2314.0 | opposite-strand | Uncharacterised BCR, YnfA/UPF0060 family |
| 10 | PF01022.22 | 1.0 | 2 | 2766.0 | opposite-strand | Bacterial regulatory protein, arsR family |
| 11 | PF12840.9 | 1.0 | 2 | 2766.0 | opposite-strand | Helix-turn-helix domain |
++ More..