Protein Information |
Information Type | Description |
---|---|
Protein name | Uncharacterized protein Mb2626 |
NCBI Accession ID | LT708304.1 |
Organism | Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) |
Left | 2897360 |
Right | 2897605 |
Strand | + |
Nucleotide Sequence | ATGCGAACAACCATCGATGTCGCAGGACGTCTGGTGATTCCCAAGCGGATTCGCGAGCGCCTTGGCTTGCGCGGGAACGACCAGGTGGAGATCACCGAGCGCGATGGGCGCATCGAGATTGAGCCGGCCCCGACCGGTGTCGAACTCGTTCGGGAAGGCTCGGTTCTCGTCGCACGGCCAGAACGTCCCCTGCCCCCGTTGACCGACGAAATCGTTCGGGAAACGCTCGATCGCACACGGCGGTGA |
Sequence | MRTTIDVAGRLVIPKRIRERLGLRGNDQVEITERDGRIEIEPAPTGVELVREGSVLVARPERPLPPLTDEIVRETLDRTRR |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of cl00877. Profile Description: Antidote-toxin recognition MazE, bacterial antitoxin. PrlF_antitoxin is a family of bacterial antitoxins that neutralizes the toxin YhaV. PrlF is labile and forms a homodimer that then binds to the YhaV toxin thereby neutralising its ribonuclease activity. Alone, it can also act as a transcription factor. The YhaV/PrlF complex binds the prlF-yhaV operon, probably regulating its expression negatively. Over-expression of PrlF leads to increased doubling time. |
Pubmed ID | 12788972 28385856 |
Domain | CDD:412624 |
Functional Category | Antitoxin_type_2_and_DNA-binding |
Uniprot ID | P65028 |
ORF Length (Amino Acid) | 81 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 2925492 | 2925737 | + | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
2 | 2995187 | 2995432 | + | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
3 | 2182530 | 2182775 | + | NZ_AP022575.1 | Mycobacterium shinjukuense |
4 | 1191856 | 1192101 | - | NZ_AP022581.1 | Mycobacterium lacus |
5 | 3571102 | 3571347 | + | NZ_AP022605.1 | Mycobacterium doricum |
6 | 3985555 | 3985767 | - | NZ_AP022618.1 | Mycolicibacterium insubricum |
7 | 4686264 | 4686518 | - | NZ_CP019066.1 | Tsukamurella tyrosinosolvens |
8 | 630232 | 630489 | + | NZ_CP049934.1 | Leucobacter insecticola |
9 | 3283228 | 3283455 | + | NZ_CP041146.1 | Nocardioides humi |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF01850.23 | 0.78 | 7 | -3 | same-strand | PIN domain |