Result : P64992
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein Mb2339 |
| NCBI Accession ID | LT708304.1 |
| Organism | Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) |
| Left | 2566492 |
| Right | 2566761 |
| Strand | + |
| Nucleotide Sequence | ATGATGAAGGAGATCGAGCTCCATCTGGTTGACGCTGCCGCCCCCAGCGGCGAGATTGCGATCAAGGACCTAGCCGCCCTCGCGACTGCTCTGCAGGAATTGACGACTCGAATCAGCCGCGACCCAATCAACACGCCCGGGCCTGGTCGCACAAAACAGTTTATGGAAGAGCTCTCGCAACTGGCCAGCGCCCCCGGGCCAGACATCGACGGCGGGATCGACCTAACTGACGATGAATTCCAGGCGTTTCTTCAGGCGGCGCGTTCGTGA |
| Sequence | MMKEIELHLVDAAAPSGEIAIKDLAALATALQELTTRISRDPINTPGPGRTKQFMEELSQLASAPGPDIDGGIDLTDDEFQAFLQAARS |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 12788972 28385856 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | P64992 |
| ORF Length (Amino Acid) | 89 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2584486 | 2584755 | + | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
| 2 | 2641593 | 2641862 | + | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000962.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF12728.9 | 1.0 | 2 | 706.5 | same-strand | Helix-turn-helix domain |
| 2 | PF19289.1 | 1.0 | 2 | 1847.0 | opposite-strand | PmbA/TldA metallopeptidase C-terminal domain |
| 3 | PF00528.24 | 1.0 | 2 | 4512.5 | same-strand | Binding-protein-dependent transport system inner membrane component |
++ More..