Result : P64986

Protein Information

• Protein name: Uncharacterized protein Mb2326c
• NCBI Accession ID: LT708304.1
• Organism: Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
• Left: 2557022
• Right: 2557231
• Strand: -
• Nucleotide Sequence: ATGAGCCACGACATTGCTACCGAGGAAGCCGACGACGGCGCGCTGGACCGTTGTGTCCTGTGCGACCTCACCGGGAAGCGAGTCGATGTCAAGGAGGCGACGTGCACCGGCCGCCCCGCCACGACGTTCGAGCAGGCATTCGCCGTGGAGCGCGATGCCGGATTCGATGACTTCCTGCACGGTCCGGTTGGCCCGCGGAGCACCCCATGA
• Sequence: MSHDIATEEADDGALDRCVLCDLTGKRVDVKEATCTGRPATTFEQAFAVERDAGFDDFLHGPVGPRSTP
• Source of smORF: Swiss-Prot
• Pubmed ID: 12788972 28385856
• Functional Category: Others
• Uniprot ID: P64986
• ORF Length (Amino Acid): 69

Conservation Analysis

No. of Species: 2

Sr.No.	Left Position	Right Position	Strand	NCBI Accession id	Species Name
1	2575016	2575225	-	NC_000962.3	Mycobacterium tuberculosis H37Rv
2	2632122	2632331	-	NC_015848.1	Mycobacterium canettii CIPT 140010059

Neighborhood Conservation Analysis

^* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
^* 'Small ORF' represents the entry/query analyzed.
^* Image generated using 'gggenes'(R-Package).

Neighborhood Representative Chosen(Species): NC_000962.3

Sr.No.	Domain	Co-occurrence Frequency	No. of species in which domain occurs with smORF	Median distance b/w smORF and domain bearing ORFs	Orientation relative to smORF	PFAM Information
1	PF00183.20	1.0	2	3014.5	same-strand	Hsp90 protein
2	PF02518.28	1.0	2	3014.5	same-strand	Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
3	PF00753.29	1.0	2	2122.5	same-strand	Metallo-beta-lactamase superfamily
4	PF01083.24	1.0	2	1309.5	opposite-strand	Cutinase
5	PF08940.13	1.0	2	961.5	opposite-strand	Domain of unknown function (DUF1918)
6	PF04909.16	1.0	2	-3.0	same-strand	Amidohydrolase