Result : P64968
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein Mb2294 |
| NCBI Accession ID | LT708304.1 |
| Organism | Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) |
| Left | 2528697 |
| Right | 2528996 |
| Strand | + |
| Nucleotide Sequence | ATGACTACCCCACCCGACAAGGCGCGGCGCCGGTTTCTTCGCGACGCCTACAAGAACGCTGAGCGCGTCGCACGAACCGCTTTGCTCACAATCGACCAGGACCAGCTTGAGCAGCTGCTCGACTACGTCGACGAGAGACTCGGCGAACAGCCTTGTGACCACACCGCCCGGCATGCGCAACGATGGGCCCAATCACACCGCATCGAATGGGAGACGCTGGCCGAGGGCCTACAAGAGTTTGGTGGCTACTGCGATTGTGAGATCGTAATGAATGTCGAACCTGAGGCGATCTTCGGCTAG |
| Sequence | MTTPPDKARRRFLRDAYKNAERVARTALLTIDQDQLEQLLDYVDERLGEQPCDHTARHAQRWAQSHRIEWETLAEGLQEFGGYCDCEIVMNVEPEAIFG |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam10905. Profile Description: Protein of unknown function (DUF2695). This bacterial family of proteins has no known function. |
| Pubmed ID | 12788972 28385856 |
| Domain | CDD:402477 |
| Functional Category | Others |
| Uniprot ID | P64968 |
| ORF Length (Amino Acid) | 99 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2545332 | 2545631 | + | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
| 2 | 2601156 | 2601455 | + | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
| 3 | 2438051 | 2438350 | + | NZ_AP022581.1 | Mycobacterium lacus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000962.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF13469.8 | 1.0 | 3 | 2522 | opposite-strand | Sulfotransferase family |
| 2 | PF02656.17 | 1.0 | 3 | 471.0 | same-strand | Domain of unknown function (DUF202) |
| 3 | PF16715.7 | 1.0 | 3 | 1252 | same-strand | Cyclodipeptide synthase |
| 4 | PF03009.19 | 0.67 | 2 | 3493.5 | opposite-strand | Glycerophosphoryl diester phosphodiesterase family |
++ More..