Protein Information |
Information Type | Description |
---|---|
Protein name | Uncharacterized protein Mb2294 |
NCBI Accession ID | LT708304.1 |
Organism | Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) |
Left | 2528697 |
Right | 2528996 |
Strand | + |
Nucleotide Sequence | ATGACTACCCCACCCGACAAGGCGCGGCGCCGGTTTCTTCGCGACGCCTACAAGAACGCTGAGCGCGTCGCACGAACCGCTTTGCTCACAATCGACCAGGACCAGCTTGAGCAGCTGCTCGACTACGTCGACGAGAGACTCGGCGAACAGCCTTGTGACCACACCGCCCGGCATGCGCAACGATGGGCCCAATCACACCGCATCGAATGGGAGACGCTGGCCGAGGGCCTACAAGAGTTTGGTGGCTACTGCGATTGTGAGATCGTAATGAATGTCGAACCTGAGGCGATCTTCGGCTAG |
Sequence | MTTPPDKARRRFLRDAYKNAERVARTALLTIDQDQLEQLLDYVDERLGEQPCDHTARHAQRWAQSHRIEWETLAEGLQEFGGYCDCEIVMNVEPEAIFG |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of pfam10905. Profile Description: Protein of unknown function (DUF2695). This bacterial family of proteins has no known function. |
Pubmed ID | 12788972 28385856 |
Domain | CDD:402477 |
Functional Category | Others |
Uniprot ID | P64968 |
ORF Length (Amino Acid) | 99 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 2545332 | 2545631 | + | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
2 | 2601156 | 2601455 | + | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
3 | 2438051 | 2438350 | + | NZ_AP022581.1 | Mycobacterium lacus |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF13469.8 | 1.0 | 3 | 2522 | opposite-strand | Sulfotransferase family |
2 | PF02656.17 | 1.0 | 3 | 471.0 | same-strand | Domain of unknown function (DUF202) |
3 | PF16715.7 | 1.0 | 3 | 1252 | same-strand | Cyclodipeptide synthase |
4 | PF03009.19 | 0.67 | 2 | 3493.5 | opposite-strand | Glycerophosphoryl diester phosphodiesterase family |