Result : P64888
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein Mb1767 |
| NCBI Accession ID | LT708304.1 |
| Organism | Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) |
| Left | 1955463 |
| Right | 1955747 |
| Strand | + |
| Nucleotide Sequence | ATGTGCGGCGACCAGTCGGATCACGTGCTGCAGCACTGGACCGTCGACATATCGATCGACGAACACGAAGGATTGACTCGGGCGAAGGCACGGCTGCGTTGGCGGGAAAAGGAATTGGTGGGTGTTGGCCTGGCAAGGCTCAATCCGGCCGACCGCAACGTCCCCGAGATCGGCGATGAACTCTCGGTCGCCCGAGCCTTGTCCGACTTGGGGAAGCGAATGTTGAAGGTGTCGACCCACGACATCGAAGCTGTTACCCATCAGCCGGCGCGATTGTTGTATTGA |
| Sequence | MCGDQSDHVLQHWTVDISIDEHEGLTRAKARLRWREKELVGVGLARLNPADRNVPEIGDELSVARALSDLGKRMLKVSTHDIEAVTHQPARLLY |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam08962. Profile Description: Domain of unknown function (DUF1876). This domain is found in a set of hypothetical bacterial proteins. |
| Pubmed ID | 12788972 28385856 |
| Domain | CDD:401058 |
| Functional Category | Others |
| Uniprot ID | P64888 |
| ORF Length (Amino Acid) | 94 |
++ More..
| Conservation Analysis |
No. of Species: 42
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1965657 | 1965941 | + | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
| 2 | 2958909 | 2959148 | - | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
| 3 | 1999915 | 2000199 | + | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
| 4 | 3030146 | 3030385 | - | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
| 5 | 185195 | 185479 | + | NZ_AP022601.1 | Mycobacterium gallinarum |
| 6 | 2210010 | 2210294 | - | NZ_AP022608.1 | Mycolicibacterium gadium |
| 7 | 4866147 | 4866431 | - | NZ_AP022560.1 | Mycolicibacterium moriokaense |
| 8 | 2857139 | 2857423 | + | NZ_AP022606.1 | Mycobacterium branderi |
| 9 | 3730983 | 3731267 | - | NZ_AP022583.1 | Mycobacterium noviomagense |
| 10 | 845509 | 845751 | - | NZ_AP022577.1 | Mycolicibacterium aubagnense |
| 11 | 2668697 | 2668939 | + | NZ_CP027793.1 | Rhodococcus hoagii |
| 12 | 1142415 | 1142693 | + | NZ_CP011883.2 | Mycobacterium haemophilum DSM 44634 |
| 13 | 1505154 | 1505432 | + | NC_008726.1 | Mycolicibacterium vanbaalenii PYR-1 |
| 14 | 240590 | 240868 | - | NZ_AP023173.1 | Rhodococcus qingshengii |
| 15 | 1151187 | 1151426 | + | NZ_AP022581.1 | Mycobacterium lacus |
| 16 | 1592373 | 1592606 | + | NZ_AP024310.1 | Mycobacterium heckeshornense |
| 17 | 5676061 | 5676300 | + | NC_022663.1 | Mycobacterium kansasii ATCC 12478 |
| 18 | 2261352 | 2261633 | + | NZ_AP018410.1 | Mycobacterium pseudoshottsii JCM 15466 |
| 19 | 34706 | 34945 | + | NZ_AP022619.1 | Mycobacterium paraseoulense |
| 20 | 717234 | 717473 | + | NZ_AP022582.1 | Mycobacterium seoulense |
| 21 | 534783 | 535049 | - | NZ_CP015235.1 | Rhodococcus fascians D188 |
| 22 | 3848467 | 3848748 | + | NZ_CP058277.1 | Mycobacterium marinum |
| 23 | 2221981 | 2222220 | - | NZ_AP022575.1 | Mycobacterium shinjukuense |
| 24 | 1736635 | 1736868 | - | NZ_AP023355.1 | Actinocatenispora thailandica |
| 25 | 2126636 | 2126872 | + | NZ_LR130759.1 | Mycobacterium basiliense |
| 26 | 1243090 | 1243359 | - | NZ_CP031142.1 | Saccharopolyspora pogona |
| 27 | 5195057 | 5195299 | + | NZ_AP022600.1 | Mycolicibacterium tokaiense |
| 28 | 3159339 | 3159611 | - | NZ_CP060713.1 | Nocardioides mesophilus |
| 29 | 18951 | 19226 | + | NZ_AP022573.1 | Mycobacterium saskatchewanense |
| 30 | 3861301 | 3861573 | - | NZ_CP072931.1 | Streptomyces auratus AGR0001 |
| 31 | 4230875 | 4231144 | - | NZ_CP019457.1 | Streptomyces lydicus |
| 32 | 4313629 | 4313901 | - | NZ_CP023691.1 | Streptomyces platensis |
| 33 | 4642089 | 4642346 | - | NZ_CP020569.1 | Streptomyces gilvosporeus |
| 34 | 4924150 | 4924407 | - | NZ_CP070326.1 | Streptomyces noursei |
| 35 | 4172638 | 4172901 | + | NZ_CP072827.1 | Streptomyces mobaraensis NBRC 13819 = DSM 40847 |
| 36 | 2632041 | 2632310 | + | NC_009142.1 | Saccharopolyspora erythraea NRRL 2338 |
| 37 | 1696815 | 1697060 | + | NZ_CP018863.1 | Arthrobacter crystallopoietes |
| 38 | 5355191 | 5355427 | + | NC_013595.1 | Streptosporangium roseum DSM 43021 |
| 39 | 5786275 | 5786523 | + | NZ_CP031455.1 | Streptomyces olivoreticuli subsp. olivoreticuli |
| 40 | 7541640 | 7541909 | - | NZ_CP061007.1 | Saccharopolyspora spinosa |
| 41 | 2244619 | 2244870 | + | NZ_CP023865.1 | Actinoplanes teichomyceticus ATCC 31121 |
| 42 | 377010 | 377258 | + | NZ_CP059164.1 | Nocardioides ungokensis |
| 43 | 1243201 | 1243470 | + | NC_015564.1 | Hoyosella subflava DQS3-9A1 |
| 44 | 970261 | 970530 | + | NZ_CP034463.1 | Streptomyces aquilus |
++ More..