Result : P64688
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Acyl carrier protein BQ2027_MB0103 |
| NCBI Accession ID | LT708304.1 |
| Organism | Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) |
| Left | 109819 |
| Right | 110055 |
| Strand | + |
| Nucleotide Sequence | GTGCGGGACCGAATCCTCGCCGCCGTCTGCGACGTGTTGTATATCGACGAGGCGGATCTCATTGATGGCGACGAAACGGATCTCCGCGACCTCGGGCTGGACTCTGTTCGGTTTGTTCTGCTGATGAAGCAGCTAGGCGTGAACCGACAATCCGAACTGCCGTCCCGATTGGCCGCGAACCCGTCGATTGCGGGTTGGCTTCGCGAGCTGGAGGCTGTGTGCACCGAGTTCGGTTAA |
| Sequence | MRDRILAAVCDVLYIDEADLIDGDETDLRDLGLDSVRFVLLMKQLGVNRQSELPSRLAANPSIAGWLRELEAVCTEFG |
| Source of smORF | Swiss-Prot |
| Function | Acyl carrier protein that accepts acyl-adenylates (acyl-AMP) from FadD10. {ECO:0000250|UniProtKB:P9WM65}. |
| Pubmed ID | 12788972 28385856 |
| Domain | CDD:415812 |
| Functional Category | Others |
| Uniprot ID | P64688 |
| ORF Length (Amino Acid) | 78 |
++ More..
| Conservation Analysis |
No. of Species: 27
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 109783 | 110019 | + | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
| 2 | 113346 | 113582 | + | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
| 3 | 187376 | 187618 | - | NZ_LR130759.1 | Mycobacterium basiliense |
| 4 | 340440 | 340637 | + | NZ_CP025546.1 | Mycobacterium paragordonae |
| 5 | 1760542 | 1760781 | - | NZ_CP058277.1 | Mycobacterium marinum |
| 6 | 5758783 | 5759022 | + | NZ_AP018410.1 | Mycobacterium pseudoshottsii JCM 15466 |
| 7 | 1237517 | 1237756 | - | NZ_AP022572.1 | Mycobacterium shottsii |
| 8 | 4212452 | 4212652 | - | NZ_CP011269.1 | Mycolicibacterium fortuitum |
| 9 | 4090692 | 4090889 | + | NZ_AP022596.1 | Mycolicibacterium helvum |
| 10 | 940384 | 940605 | - | NZ_AP022618.1 | Mycolicibacterium insubricum |
| 11 | 2344501 | 2344692 | - | NZ_AP022577.1 | Mycolicibacterium aubagnense |
| 12 | 1353027 | 1353224 | + | NZ_AP022589.1 | Mycolicibacter minnesotensis |
| 13 | 2322142 | 2322333 | + | NZ_CP029543.1 | Mycobacterium leprae |
| 14 | 2337761 | 2337952 | - | NZ_CP011883.2 | Mycobacterium haemophilum DSM 44634 |
| 15 | 5611629 | 5611829 | + | NZ_AP022565.1 | Mycolicibacterium alvei |
| 16 | 4887930 | 4888130 | + | NZ_AP022616.1 | Mycolicibacterium phocaicum |
| 17 | 3337609 | 3337848 | + | NZ_AP018164.1 | Mycobacterium shigaense |
| 18 | 648458 | 648664 | + | NZ_CP014955.1 | Mycobacteroides abscessus |
| 19 | 568554 | 568760 | + | NZ_CP024633.1 | Mycobacteroides salmoniphilum |
| 20 | 573608 | 573814 | + | NZ_CP010271.1 | Mycobacteroides saopaulense |
| 21 | 4859437 | 4859637 | - | NZ_CP062008.1 | Mycolicibacterium mucogenicum DSM 44124 |
| 22 | 3412269 | 3412469 | + | NZ_AP022579.1 | Mycolicibacterium boenickei |
| 23 | 610819 | 611058 | + | NZ_AP018165.1 | [Mycobacterium] stephanolepidis |
| 24 | 618996 | 619235 | + | NZ_CP007220.1 | Mycobacteroides chelonae CCUG 47445 |
| 25 | 779907 | 780113 | + | NZ_CP011530.1 | Mycobacteroides immunogenum |
| 26 | 2524250 | 2524483 | + | NZ_AP022603.1 | Mycolicibacterium fallax |
| 27 | 3611512 | 3611745 | + | NZ_AP022595.1 | Mycolicibacterium sarraceniae |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000962.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00823.21 | 0.74 | 20 | 3141 | same-strand | PPE family |
| 2 | PF18878.2 | 0.63 | 17 | 3155.0 | same-strand | PPE-PPW subfamily C-terminal region |
| 3 | PF02668.18 | 0.96 | 26 | 2172.5 | same-strand | Taurine catabolism dioxygenase TauD, TfdA family |
| 4 | PF10862.10 | 1.0 | 27 | 1629 | same-strand | FcoT-like thioesterase domain |
| 5 | PF00501.30 | 1.0 | 27 | 5.0 | same-strand | AMP-binding enzyme |
| 6 | PF13193.8 | 1.0 | 27 | 38 | same-strand | AMP-binding enzyme C-terminal domain |
| 7 | PF00403.28 | 0.7 | 19 | 5152 | same-strand | Heavy-metal-associated domain |
++ More..