Result : P64659
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein HP_0386 |
| NCBI Accession ID | AE000511.1 |
| Organism | Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) |
| Left | 395532 |
| Right | 395768 |
| Strand | + |
| Nucleotide Sequence | ATGTCTTTAGAAAACGATAGCTTAGAAATCACTTATTTAGGCAAACGCTATAAAATCTCTCTCAATAACACCTTTAGCGATGAGATGAAACGCACCCTAAAGGAGCGTTTCCATAACCAAGAATTAAACGCCTTAGAGCTTTTAAAGGATTATTTGCATGAAAGTTGTCAAAACGAGTATTTGCACAATGAACTCCAAAAGCTTTTAGAAAAAATCTCATCATGTTCTATCACTTAA |
| Sequence | MSLENDSLEITYLGKRYKISLNNTFSDEMKRTLKERFHNQELNALELLKDYLHESCQNEYLHNELQKLLEKISSCSIT |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 9252185 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | P64659 |
| ORF Length (Amino Acid) | 78 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1117299 | 1117535 | - | NC_017379.1 | Helicobacter pylori Puno135 |
| 2 | 366692 | 366928 | - | NC_008229.1 | Helicobacter acinonychis str. Sheeba |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_017379.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02777.20 | 1.0 | 2 | 2633.5 | opposite-strand | Iron/manganese superoxide dismutases, C-terminal domain |
| 2 | PF00081.24 | 1.0 | 2 | 2633.5 | opposite-strand | Iron/manganese superoxide dismutases, alpha-hairpin domain |
| 3 | PF13649.8 | 1.0 | 2 | 1861.5 | opposite-strand | Methyltransferase domain |
| 4 | PF08242.14 | 1.0 | 2 | 1861.5 | opposite-strand | Methyltransferase domain |
| 5 | PF08241.14 | 1.0 | 2 | 1861.5 | opposite-strand | Methyltransferase domain |
| 6 | PF00270.31 | 1.0 | 2 | -15.0 | same-strand | DEAD/DEAH box helicase |
| 7 | PF04851.17 | 1.0 | 2 | -15.0 | same-strand | Type III restriction enzyme, res subunit |
| 8 | PF18074.3 | 1.0 | 2 | -15.0 | same-strand | Primosomal protein N C-terminal domain |
| 9 | PF18319.3 | 1.0 | 2 | -15.0 | same-strand | PriA DNA helicase Cys-rich region (CRR) domain |
| 10 | PF17764.3 | 1.0 | 2 | -15.0 | same-strand | 3'DNA-binding domain (3'BD) |
| 11 | PF06005.14 | 1.0 | 2 | 13.0 | same-strand | Cell division protein ZapB |
++ More..