Result : P64656

Protein Information

• Protein name: Uncharacterized protein jhp_0123
• NCBI Accession ID: AE001439.1
• Organism: Helicobacter pylori (strain J99 / ATCC 700824) (Campylobacter pylori J99)
• Left: 139412
• Right: 139546
• Strand: +
• Nucleotide Sequence: ATGAGAATTTCTCTTTTAGCTGTAATTTTAGCGTTATTGTTTGTGGCTTGCCATGAAACTAAAAAACAAATTTTGCAAAACGAAGCCGATAGCACCCCCTCAGAAAAGACCATTTGGCAACCTGAACAAAAATAA
• Sequence: MRISLLAVILALLFVACHETKKQILQNEADSTPSEKTIWQPEQK
• Source of smORF: Swiss-Prot
• Pubmed ID: 9923682
• Functional Category: Others
• Uniprot ID: P64656
• ORF Length (Amino Acid): 44

Conservation Analysis

No. of Species: 4

Sr.No.	Left Position	Right Position	Strand	NCBI Accession id	Species Name
1	136465	136599	+	NC_017379.1	Helicobacter pylori Puno135
2	1639078	1639212	-	NC_017735.1	Helicobacter cetorum MIT 99-5656
3	269365	269499	+	NC_008229.1	Helicobacter acinonychis str. Sheeba
4	621648	621782	-	NC_014810.2	Helicobacter felis ATCC 49179

Neighborhood Conservation Analysis

^* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
^* 'Small ORF' represents the entry/query analyzed.
^* Image generated using 'gggenes'(R-Package).

Neighborhood Representative Chosen(Species): NC_017379.1

Sr.No.	Domain	Co-occurrence Frequency	No. of species in which domain occurs with smORF	Median distance b/w smORF and domain bearing ORFs	Orientation relative to smORF	PFAM Information
1	PF03313.17	0.75	3	2919	opposite-strand	Serine dehydratase alpha chain
2	PF03315.17	0.75	3	2919	opposite-strand	Serine dehydratase beta chain
3	PF03222.15	0.75	3	1678	opposite-strand	Tryptophan/tyrosine permease family
4	PF01474.18	1.0	4	113.5	same-strand	Class-II DAHP synthetase family