Protein Information |
Information Type | Description |
---|---|
Protein name | Uncharacterized protein jhp_0123 |
NCBI Accession ID | AE001439.1 |
Organism | Helicobacter pylori (strain J99 / ATCC 700824) (Campylobacter pylori J99) |
Left | 139412 |
Right | 139546 |
Strand | + |
Nucleotide Sequence | ATGAGAATTTCTCTTTTAGCTGTAATTTTAGCGTTATTGTTTGTGGCTTGCCATGAAACTAAAAAACAAATTTTGCAAAACGAAGCCGATAGCACCCCCTCAGAAAAGACCATTTGGCAACCTGAACAAAAATAA |
Sequence | MRISLLAVILALLFVACHETKKQILQNEADSTPSEKTIWQPEQK |
Source of smORF | Swiss-Prot |
Function | |
Pubmed ID | 9923682 |
Domain | |
Functional Category | Others |
Uniprot ID | P64656 |
ORF Length (Amino Acid) | 44 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 136465 | 136599 | + | NC_017379.1 | Helicobacter pylori Puno135 |
2 | 1639078 | 1639212 | - | NC_017735.1 | Helicobacter cetorum MIT 99-5656 |
3 | 269365 | 269499 | + | NC_008229.1 | Helicobacter acinonychis str. Sheeba |
4 | 621648 | 621782 | - | NC_014810.2 | Helicobacter felis ATCC 49179 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF03313.17 | 0.75 | 3 | 2919 | opposite-strand | Serine dehydratase alpha chain |
2 | PF03315.17 | 0.75 | 3 | 2919 | opposite-strand | Serine dehydratase beta chain |
3 | PF03222.15 | 0.75 | 3 | 1678 | opposite-strand | Tryptophan/tyrosine permease family |
4 | PF01474.18 | 1.0 | 4 | 113.5 | same-strand | Class-II DAHP synthetase family |