Protein Information |
Information Type | Description |
---|---|
Protein name | Uncharacterized protein jhp_0112 |
NCBI Accession ID | AE001439.1 |
Organism | Helicobacter pylori (strain J99 / ATCC 700824) (Campylobacter pylori J99) |
Left | 127876 |
Right | 128007 |
Strand | + |
Nucleotide Sequence | TTGTATAGGCGGTTATTGTTGAATTTGTTTTGTATGGTATTTTTACAAGCGTGTTTGAAGCCTATGAGCGACCCTAAAGCTGAGAAAGTGGATTCGCAAGTGCAATGCGGGTTTGGCTCAAAAGATTGCTAA |
Sequence | MYRRLLLNLFCMVFLQACLKPMSDPKAEKVDSQVQCGFGSKDC |
Source of smORF | Swiss-Prot |
Function | |
Pubmed ID | 9923682 |
Domain | |
Functional Category | Others |
Uniprot ID | P64654 |
ORF Length (Amino Acid) | 43 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 125267 | 125398 | + | NC_017379.1 | Helicobacter pylori Puno135 |
2 | 1263631 | 1263771 | - | NC_008229.1 | Helicobacter acinonychis str. Sheeba |
3 | 713029 | 713145 | - | NC_017735.1 | Helicobacter cetorum MIT 99-5656 |
4 | 886000 | 886116 | + | NC_014810.2 | Helicobacter felis ATCC 49179 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF01326.21 | 0.75 | 3 | 188 | opposite-strand | Pyruvate phosphate dikinase, AMP/ATP-binding domain |
2 | PF02896.20 | 0.75 | 3 | 188 | opposite-strand | PEP-utilising enzyme, PEP-binding domain |
3 | PF00391.25 | 0.75 | 3 | 188 | opposite-strand | PEP-utilising enzyme, mobile domain |
4 | PF00587.27 | 1.0 | 4 | 35.0 | same-strand | tRNA synthetase class II core domain (G, H, P, S and T) |
5 | PF03129.22 | 1.0 | 4 | 35.0 | same-strand | Anticodon binding domain |
6 | PF07973.16 | 1.0 | 4 | 35.0 | same-strand | Threonyl and Alanyl tRNA synthetase second additional domain |
7 | PF05198.18 | 1.0 | 4 | 1870.0 | same-strand | Translation initiation factor IF-3, N-terminal domain |
8 | PF00707.24 | 1.0 | 4 | 1870.0 | same-strand | Translation initiation factor IF-3, C-terminal domain |
9 | PF01632.21 | 1.0 | 4 | 2470.0 | same-strand | Ribosomal protein L35 |
10 | PF00453.20 | 1.0 | 4 | 2757.5 | same-strand | Ribosomal protein L20 |
11 | PF01856.19 | 0.75 | 3 | 3307 | same-strand | Helicobacter outer membrane protein |