Result : P64652
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein jhp_0078 |
| NCBI Accession ID | AE001439.1 |
| Organism | Helicobacter pylori (strain J99 / ATCC 700824) (Campylobacter pylori J99) |
| Left | 86134 |
| Right | 86322 |
| Strand | - |
| Nucleotide Sequence | ATGCAAAAAGAACAAGAAGCCCAAGAAATCGCTAAAAAAGCCGTTAAAATCGTGTTTTTTTTAGGGCTTGTGGTGGTGCTTTTGATGATGATAAACCTTTACATGCTTATCAATCAAATCAATGCGAGTGCTCAAATGAGCCACCAAATCAAAAAGATAGAAGAAAGGCTTAACCAAGAGCAAAAATAA |
| Sequence | MQKEQEAQEIAKKAVKIVFFLGLVVVLLMMINLYMLINQINASAQMSHQIKKIEERLNQEQK |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam17402. Profile Description: Family of unknown function (DUF5408). This is a family of unknown function found in Helicobacteraceae. Family members are predicted to contain one trans-membrane region. |
| Pubmed ID | 9923682 |
| Domain | CDD:340117 |
| Functional Category | Others |
| Uniprot ID | P64652 |
| ORF Length (Amino Acid) | 62 |
++ More..
| Conservation Analysis |
No. of Species: 5
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 84181 | 84369 | - | NC_017379.1 | Helicobacter pylori Puno135 |
| 2 | 1323367 | 1323555 | + | NC_008229.1 | Helicobacter acinonychis str. Sheeba |
| 3 | 1029543 | 1029737 | + | NZ_LN907858.1 | Helicobacter typhlonius |
| 4 | 1681415 | 1681606 | - | NC_004917.1 | Helicobacter hepaticus ATCC 51449 |
| 5 | 750516 | 750704 | + | NC_017735.1 | Helicobacter cetorum MIT 99-5656 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_017379.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00015.23 | 0.6 | 3 | 1235 | same-strand | Methyl-accepting chemotaxis protein (MCP) signalling domain |
| 2 | PF00380.21 | 0.6 | 3 | 701 | same-strand | Ribosomal protein S9/S16 |
| 3 | PF00572.20 | 0.6 | 3 | 279 | same-strand | Ribosomal protein L13 |
| 4 | PF06039.17 | 0.6 | 3 | 7 | same-strand | Malate:quinone oxidoreductase (Mqo) |
| 5 | PF01266.26 | 0.6 | 3 | 7 | same-strand | FAD dependent oxidoreductase |
| 6 | PF00877.21 | 0.8 | 4 | 1417.0 | same-strand | NlpC/P60 family |
| 7 | PF12913.9 | 1.0 | 5 | 1421 | same-strand | SH3 domain (SH3b1 type) |
| 8 | PF12912.9 | 1.0 | 5 | 1421 | same-strand | NLPC P60 stabilising domain, N term |
| 9 | PF12914.9 | 1.0 | 5 | 1421 | same-strand | SH3 domain of SH3b2 type |
| 10 | PF04539.18 | 0.6 | 3 | 2807 | same-strand | Sigma-70 region 3 |
| 11 | PF04542.16 | 0.6 | 3 | 2807 | same-strand | Sigma-70 region 2 |
| 12 | PF04545.18 | 0.6 | 3 | 2807 | same-strand | Sigma-70, region 4 |
| 13 | PF00140.22 | 0.6 | 3 | 2807 | same-strand | Sigma-70 factor, region 1.2 |
| 14 | PF01048.22 | 0.6 | 3 | 5017 | same-strand | Phosphorylase superfamily |
| 15 | PF00698.23 | 0.6 | 3 | 5723 | same-strand | Acyl transferase domain |
++ More..